SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526940|ref|YP_003668964.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297526940|ref|YP_003668964.1|
Domain Number - Region: 66-134
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0014
Family Galactokinase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526940|ref|YP_003668964.1|
Sequence length 139
Comment hypothetical protein Shell_0959 [Staphylothermus hellenicus DSM 12710]
Sequence
MSELLELAKRMIKAFKTFECYVFEKKEIGKVRELLVKAGIRSLVRIRKADPRYPYIYVVV
PWSREFEKICVAKVKELLAEGRIDRESYNKRYNELIAQCIRHHERERVKEIIEKLEKYIG
KGSGGGFGGKTTIFSSEFP
Download sequence
Identical sequences D7D8G9
gi|297526940|ref|YP_003668964.1| WP_013143263.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]