SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297527157|ref|YP_003669181.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297527157|ref|YP_003669181.1|
Domain Number - Region: 308-348
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 0.0948
Family CTP-dependent riboflavin kinase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297527157|ref|YP_003669181.1|
Sequence length 372
Comment peptidase M50 [Staphylothermus hellenicus DSM 12710]
Sequence
MKQLSRAGRLATHIKDYTVEKTGKVFDIVINERLDEKVFNEIYSYIVDKYSYMILQLRTD
PPTLRLIPIRKGNPKIKQIILLLTTIVTIFLTGYGITISFYELLRRINNQLVINQLVIIE
WSIIYTALFLFALGFHEFGHMFSSKKSGVIIEGPYFIPAPPIQLGFIGTLGAVISMKSLP
PTRRDLAKLGISGPLFGYIVALIIGFIGVMFSPTIPISMSRELVESGQASEIGFMPLTMI
LLLLIRNISSGNTVLLHPLAFISFIIFIVTFLNLLPIGQLDGGHVVRSFTTAYTHELIGY
FIIISTAVTGVFLLGTMAGQYYIALSIILVIFKLLFGRHPHPGPANQFSSSKDYSILLAY
ILLIVLTLPLPV
Download sequence
Identical sequences D7D936
WP_013143480.1.49614 gi|297527157|ref|YP_003669181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]