SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297527218|ref|YP_003669242.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297527218|ref|YP_003669242.1|
Domain Number - Region: 760-858
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00175
Family HBL-like 0.043
Further Details:      
 
Domain Number - Region: 393-430
Classification Level Classification E-value
Superfamily E set domains 0.00747
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297527218|ref|YP_003669242.1|
Sequence length 863
Comment putative methyl-accepting chemotaxis sensory transducer [Staphylothermus hellenicus DSM 12710]
Sequence
MTTRSLFGIILLVSMVLALGIGTLPVIQIARATITGRPTVYFFNGTNITTGDPLSVPAFL
GTGQYLAIDLRNTSISGAQIWVWFSKDGSATIASGDAVYIGPIYMGDVVASTPATIQVPV
YAPFNKTVGDYVAVSIGYNWVNITKLPGMFDGGTTYWIKVTDVNPSERPNIPSSDVAVST
NRLMFEPSFDAYSVVDNDFTTVPNEPIIVRGYSTAIGGEYDVTVDSSVVATVSTQVITEP
AVPPNPEWTWGGFEAQIEAPDLELRLGTENASSFTVSVMNNSATLASWNFTQEPRRVCID
STPYENEGDYTGSLILNTGEQYSIRMRNFPYEGSVDIKLDNTVIATNVALDEHGSVLNYT
IVIPYLPSGTYNMTFTDNDGVVYWFKVTVNLTVTPYITVEPTEGYVGDQVTVCGYNFNAY
EGQNINIWFHVSSITGMYYRALNFTVPAPHWCVVITVPNATYGSHYVLATEDDPLAPQYT
TTPPNEIARTEFFVKSKLVVEPAKVSCNGEMLKIIGTGFPGHHDYDIIIDMSYFYLARSD
DYGFLHAKVPVTGCCCGGVHSVALYDSSGPAVPVAVAYFNVTGPTLQDVMNRLDSINGSL
VSIQGDIAVIQTQLGDVRVGIDDLKAMITSMGDEVLLKLDDMNSSLANLVITKNGEVVAT
ITAQIDELRPIIRDINNGVATIQTNLGTVMADASAILGNQARILELVVVNNNTLAVIQTK
VGEVLASINAVNDLINSKVLVDTGNILSKLDSVMGSLADIKSMSTDVKGGINDIKNSLSG
LNGKVDDLSGKIDSSTSTLSSKIDKSTGDLSSKIDNLGTSITDKLSKSTGDLTNLVNMYG
ITSIILIIIAIVAALYGAFRKKP
Download sequence
Identical sequences D7D997
gi|297527218|ref|YP_003669242.1| WP_013143541.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]