SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297527320|ref|YP_003669344.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527320|ref|YP_003669344.1|
Domain Number 1 Region: 10-289
Classification Level Classification E-value
Superfamily Folate-binding domain 1.37e-64
Family Aminomethyltransferase folate-binding domain 0.0000139
Further Details:      
 
Domain Number 2 Region: 282-371
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 6.05e-20
Family Aminomethyltransferase beta-barrel domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297527320|ref|YP_003669344.1|
Sequence length 373
Comment glycine cleavage system T protein [Staphylothermus hellenicus DSM 12710]
Sequence
MKTLAKIPLLNYHVEKLGAEPGFFGDWEVPMRYTSSIEEHLAVRRDVGVFDVSHMGRIRL
KGSDVFELIQYVYTKDLSKVKTGWMSGPTLALNQWARVKDDEMLYKIRDDEWLLVPNALV
REKMLSYLRSIINNRQYKVVIEDLTFKYSMIAIQGPKSPDIMEKIGLKDASDLKPLQFIT
NIKLNDIKLFLISRSGWTGEDGFEVWGDHSSIAKLLDILVKEGVKPAGIIARDTLRMEMG
FVLGDHEYGEDPVKYPCAISLRYGLGAITWSKKGYVGEEALRACLREGVRWVRMGIKMSK
KNARIIPREHMPVYVEDQVVGWITSGTYSPILRRGIAQAYIDARYAIEDLPVKIMMRNRF
YEGKIVDFPFITK
Download sequence
Identical sequences D7D9J9
gi|297527320|ref|YP_003669344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]