SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297527360|ref|YP_003669384.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297527360|ref|YP_003669384.1|
Domain Number 1 Region: 7-229
Classification Level Classification E-value
Superfamily alpha/beta knot 7.59e-65
Family EMG1/NEP1-like 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297527360|ref|YP_003669384.1|
Sequence length 230
Comment Suppressor Mra1 family protein [Staphylothermus hellenicus DSM 12710]
Sequence
MDMGEPISIILLESALELVPRELWKHPAVLKNARRRGKKPGKTLLDVSLHYHAMRKLKDR
EKRGRPDIVHISLLNALESPLNKEGYLRIYIHTYPGHIIFVKPETRIPRNYNRFVGLMEQ
LLIHGKVPPDSDDPLLYVKTMTISDLLEKINKNGIILLREQGEKEKPENIVKYAIENNYA
IGIGGFPHGDYSEEIIDMSKAEFSIYNKPLTTWITVSRVIVGAENLFKII
Download sequence
Identical sequences D7D9N9
WP_013143683.1.49614 gi|297527360|ref|YP_003669384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]