SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300853244|ref|YP_003778228.1| from Clostridium ljungdahlii DSM 13528

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300853244|ref|YP_003778228.1|
Domain Number 1 Region: 42-113
Classification Level Classification E-value
Superfamily CPE0013-like 4.45e-24
Family CPE0013-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300853244|ref|YP_003778228.1|
Sequence length 116
Comment hypothetical protein CLJU_c00160 [Clostridium ljungdahlii DSM 13528]
Sequence
MIKERTGTKFDRQCIDIKDREDIKENLYSGEENLKLKEDNKCDIFTTIVRIKGCNCNVVP
VKSSKPLDKSLWLECSKVLARIHVGAPIKIGDIICKNILNTKVDIICTKNVNKITK
Download sequence
Identical sequences D8GK08 U5RXU3
WP_013236726.1.13159 WP_013236726.1.37247 WP_013236726.1.41750 WP_013236726.1.46135 WP_013236726.1.69619 WP_013236726.1.91913 gi|554379906|ref|YP_008699605.1| gi|300853244|ref|YP_003778228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]