SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300854459|ref|YP_003779443.1| from Clostridium ljungdahlii DSM 13528

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300854459|ref|YP_003779443.1|
Domain Number 1 Region: 81-168
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000445
Family Apolipoprotein 0.02
Further Details:      
 
Weak hits

Sequence:  gi|300854459|ref|YP_003779443.1|
Domain Number - Region: 25-93
Classification Level Classification E-value
Superfamily GatB/YqeY motif 0.0256
Family GatB/GatE C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300854459|ref|YP_003779443.1|
Sequence length 174
Comment hypothetical protein CLJU_c12730 [Clostridium ljungdahlii DSM 13528]
Sequence
MDAIKLIEYLEEIINTSAKVPMTGKVMVNKKEILDVLQKIVDYLPSELKKAQWIVNEKER
ILSEAVQESETMKKENLSLLRRQIENHDITKEANMRAEEIISSAKKNAKAIRLGARDYAD
ELLSQLDNELSRKNDEMLATLKVELQKMLNNLVNSMDLKTEDIRANIKELRDMK
Download sequence
Identical sequences D8GRY8
gi|300854459|ref|YP_003779443.1| WP_013237938.1.41750 WP_013237938.1.46135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]