SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300856890|ref|YP_003781874.1| from Clostridium ljungdahlii DSM 13528

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300856890|ref|YP_003781874.1|
Domain Number 1 Region: 47-120
Classification Level Classification E-value
Superfamily CPE0013-like 2.48e-26
Family CPE0013-like 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|300856890|ref|YP_003781874.1|
Domain Number - Region: 7-59
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00628
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300856890|ref|YP_003781874.1|
Sequence length 124
Comment hypothetical protein CLJU_c37460 [Clostridium ljungdahlii DSM 13528]
Sequence
MSTRELTCIGCPIGCQLLVKINKDKVVEVTGNTCKNGKEYGEKECTNPTRIVTSSVYVEG
GEIDVLPVKTERDIPKDRVFDCIKLLKGKIVKAPIKIGDIIVENVVNSGINIIATKNVKR
SKRS
Download sequence
Identical sequences A0A162LAJ7 D8GTV9
gi|300856890|ref|YP_003781874.1| WP_013240350.1.28696 WP_013240350.1.41750 WP_013240350.1.42822 WP_013240350.1.46135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]