SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300857231|ref|YP_003782215.1| from Clostridium ljungdahlii DSM 13528

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300857231|ref|YP_003782215.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.47e-36
Family Ribosomal protein L6 0.0000305
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.6e-26
Family Ribosomal protein L6 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300857231|ref|YP_003782215.1|
Sequence length 180
Comment 50S ribosomal protein L6 [Clostridium ljungdahlii DSM 13528]
Sequence
MSRIGKLPIAIPSGVTFTVTPDNVVTVKGPKGQLVKAMRKDMNIAVEDNSIVVKRNNDEK
ESRALHGLTRALINNMVIGVTEGYAKTLELVGVGYRAQLQGKKLVLNLGFSHPIEVEAVE
GITFETPAPTKVIVKGIDKELVGDVSADIRNWRRPEPYKGKGIKYENEVIRRKEGKTGKK
Download sequence
Identical sequences D8GIN9
gi|300857231|ref|YP_003782215.1| WP_013240677.1.13159 WP_013240677.1.28696 WP_013240677.1.37247 WP_013240677.1.41750 WP_013240677.1.42822 WP_013240677.1.46135 WP_013240677.1.69619 WP_013240677.1.91913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]