SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300857392|ref|YP_003782376.1| from Clostridium ljungdahlii DSM 13528

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300857392|ref|YP_003782376.1|
Domain Number 1 Region: 56-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.7e-24
Family Ribosomal protein L9 C-domain 0.00036
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 2.27e-17
Family Ribosomal protein L9 N-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300857392|ref|YP_003782376.1|
Sequence length 147
Comment 50S ribosomal protein L9 [Clostridium ljungdahlii DSM 13528]
Sequence
MKVILLKDVKTLGKKGQVINASDGYARNYLIPRGVAEEANQSNLHILNNKKEAERKEKLA
EIEAAQKLAASLKGKEIKLTVKSGENGRLFGSITGKDISDELNKKFHINVDKKKIAVNNI
RQLGTYDVEVKLYPEISTKIKVVIAEK
Download sequence
Identical sequences A0A166T3J5 A0A1A6AQ42 D8GJX2 U5RUA8
WP_013240836.1.13159 WP_013240836.1.28696 WP_013240836.1.37247 WP_013240836.1.41750 WP_013240836.1.42822 WP_013240836.1.46135 WP_013240836.1.688 WP_013240836.1.69619 WP_013240836.1.91913 gi|554379872|ref|YP_008699571.1| gi|300857392|ref|YP_003782376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]