SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297582349|ref|YP_003698129.1| from Bacillus selenitireducens MLS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297582349|ref|YP_003698129.1|
Domain Number 1 Region: 1-326
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.82e-64
Family beta-Lactamase/D-ala carboxypeptidase 0.0000175
Further Details:      
 
Domain Number 2 Region: 319-413,447-454
Classification Level Classification E-value
Superfamily Penicillin-binding protein associated domain 0.000000000000373
Family PBP5 C-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297582349|ref|YP_003698129.1|
Sequence length 465
Comment peptidase S11 D-alanyl-D-alanine carboxypeptidase 1 [Bacillus selenitireducens MLS10]
Sequence
MLKKWGYALAAVTVSAAVLVPTERAEASYEPTVDTVILVDAKSGRVLFERNIDQPLPPAS
MTKMMSEYLILEAVNDGDISWDTNVPISDFLASLSHNRSLSNVPLRVDGEYNVEELYESV
AIYSANASTMALAELISGSEGAFVSEMNEKGVELGLGTLMREAGGEYGLEDLGEISEEGL
GSFQFVNSTGLPNRLLEGNHPEGTGAEEDNYMSARAAATLAYYLVNDYPEVLDVAGIPHK
VFREGTGDAIDMPNWNNMIPGTENSHLDYEYVDGLKTGHTNAAGFTFTGTGEKDGQRLVS
VVMGADSIEHRFQETQRVLEWGFNTFYEEEIYAAGYSPDGFETIAVSKGEEEEVPLESTE
AIHRLIQEGDEELYSYEVVLDEDLLDEDGAMEAPVEAGTVVGQMIISFDGEEDYIHDEID
RTTVVDLITTSDVERSGWFTLMLESIGGFFTGLWHSVTETVRGWL
Download sequence
Identical sequences D6XV05
gi|297582349|ref|YP_003698129.1| WP_013170993.1.4048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]