SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297583578|ref|YP_003699358.1| from Bacillus selenitireducens MLS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297583578|ref|YP_003699358.1|
Domain Number 1 Region: 265-281,339-739
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.45e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.0000119
Further Details:      
 
Domain Number 2 Region: 77-300
Classification Level Classification E-value
Superfamily Lysozyme-like 1.01e-61
Family PBP transglycosylase domain-like 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297583578|ref|YP_003699358.1|
Sequence length 1011
Comment glycosyl transferase family 51 protein [Bacillus selenitireducens MLS10]
Sequence
MNDFFSTIKQLFSRKEPQVVIKGVRITTKVAWNLVLLFLTLTVIMGAFAGGAAAGYFASL
VKDEPIPAFEEMERSIYNYEEATEVYFADEVLLGDLPSPLERREVSIDQISDHLINAVIA
TEDEYFFEHEGVVPKALFRALYQDFSNAATQTGGSTLTQQLVKNQLLTSEVTHDRKAIEI
LYAMRLEHHLDKEDILEAYMNIVPFGRNSNGRQVAGVEAAARGLFDVSASELSLSQAAYI
AGLPQSPFAHTPFTSSGEVKEDLSSGLSRMNTVLNRMYASGYITAEEREQALDFDLENEL
RDRQPSSRQQYPWVLEIAREYAIPVIRDILLEQDDINIDDIEDDDQRQLTLNRYTELAER
SMMQDGYQIHTTINKDIYDAQQEVIREFDYYGPDKSPPEGGETQPEEASSVLINNQTGAI
VSFVAGRDFEERQTNTAIRNSGYSGRPTGSTMKSLTTYPFAFETGQLQPGILAPDTPYIY
PGTDQDVRNFDGLNYRGLITSREALIQSRNTPAVREFAEMDWDEVGEMLDRFGLDQYNSR
NNLRHSFPLGPDNVALDQQVSAFSTYANDGIRNKQYIIEKITDANGEVLYEHETQEIEVL
SPQTSYLMYDVMRDVVNANNGTARNLPSYLDFSSDWAGKTGTSQGFSDVLFIGINPNITM
GSWIGYYNNAQLDRTHSSGFSYSIRNQMLWADLMNAAYEIDPDLIGPSETKSSPGGIVSQ
SVCAISGKLPSDLCREAGLVETDLFNSRYAPTEEDDSLTRVRYVRVEDDHYKALDTTPEE
FTKPGVSVKEEYFEFADGDITQYLPDDWDDLVPDIDAPDNGRTPDVLTSGSTDGSSVTWG
AHPESDVIGYRLYHSPSEDADPALIDSFIWDDDRTFRGPEGAYFITAVDVAGRESSYSEP
VIVGEYVSPEDEEEDEEPEEETPDNENNNQNENEDNDQNNNNQNNNSSNNNQNNNQPDNN
TNDPNNTPDNNESNNDDSNSGNDENVSSSNDENQSNGSNANNDATREDDDE
Download sequence
Identical sequences D6XSK6
WP_013172216.1.4048 gi|297583578|ref|YP_003699358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]