SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297584259|ref|YP_003700039.1| from Bacillus selenitireducens MLS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297584259|ref|YP_003700039.1|
Domain Number 1 Region: 21-405
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 3.53e-131
Family ArgJ-like 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297584259|ref|YP_003700039.1|
Sequence length 409
Comment arginine biosynthesis bifunctional protein ArgJ [Bacillus selenitireducens MLS10]
Sequence
MMTTTDEQTVTILDQGHVTSPKGFKAGGVHCGLRKTKLDFGWIHSDKPANAAGVYTLNSF
KAAPLHVTKAAIDSNGKIQTIITNSAVANSCTGPEGEENAKLMQQLAAEKMHVNVQDVAV
LSTGVIGVQLPMNEIKQGIQSMTHDENYGAERFEQAILTTDTVTKHTAVTCIIDGHKITI
GGAAKGSGMIHPNMATMLAYMTTDANVGQKALQHVLSDVTNDTYNMITVDGDSSTNDTVL
FLANGEQPNQELTPEHPEWPVFKEAVKTVAETLAKKIAQDGEGATKLVAVHVQNASSKPS
ARKVAKAVISSNLVKTAVYGADPNWGRIVCAVGYSEEPVDPNIVEVKLGPTTVVSDGLPV
AFDESKSKEYLSNEQIDIYVNLNQGNENACAWGCDLTYQYVKINASYRT
Download sequence
Identical sequences D6XUI7
gi|297584259|ref|YP_003700039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]