SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297584607|ref|YP_003700387.1| from Bacillus selenitireducens MLS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297584607|ref|YP_003700387.1|
Domain Number 1 Region: 309-657
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.85e-66
Family beta-Lactamase/D-ala carboxypeptidase 0.0038
Further Details:      
 
Domain Number 2 Region: 55-115,182-307
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.55e-36
Family Penicillin binding protein dimerisation domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297584607|ref|YP_003700387.1|
Sequence length 681
Comment penicillin-binding protein transpeptidase [Bacillus selenitireducens MLS10]
Sequence
MAKQKRMKPHIPLRLNLLFFLVFILFSALILRLGVVQIVQGEEFQEVVERTNSEITPVEA
PRGLVYDRHGNLLVGNEHIHTVTFTNRRTSAQEMLDVSLLLSDLIDVDTDHVFESRYEQE
RRDFWSVLYDEEFEDKLPLEEAQAREMSDGDVYRERIDAITDQDLEMVTDQEWEAFAVWR
ELRQGMNNVPHKISSVSHEEAARIMENMENLPGIDVIRDAERVYPFGSYLRGILGNVGSI
RSENLDQFLSQGYERTDRVGTTYLEAQYESVLRGRPGSIETFTDSDGNHTEPPVERQGSR
GNDLMLSFDLELQQRVEDLVDSITMERSGSFVAEPDAHVVMMEPDTGDILAMYGNGSTSP
PMGQSYEMGSTVKGATLLTGYNHGLITPGEVIVDRPTTLGVGGGGTISSVVNMGAINDLQ
ALERSSNIYMATVAMRLVGYTPGVSTSWGSYQFGYDWIRQQFGEFGLGVSTGIDLPGEST
GIVGQNISQPGNMVFLTYGQYDTYTPLQLAQYTATIANDGVRVAPRVVTEIREPSNVRGE
IGPVAEVKKPKIMNIIDTDPSYFDRIKEGFYRVVYGDRGTARAYFQNRDYTVGGKTGTAQ
SFYDGQSVNNQTFVAFAPFDEPEVVISVVVPFVSTAEGNAGIANTIAEAALDAYFDLQEG
RNGPREPESSGDEDESSDDES
Download sequence
Identical sequences D6XW67
WP_013173243.1.4048 gi|297584607|ref|YP_003700387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]