SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297584844|ref|YP_003700624.1| from Bacillus selenitireducens MLS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297584844|ref|YP_003700624.1|
Domain Number 1 Region: 217-239,266-615
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.82e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.00014
Further Details:      
 
Domain Number 2 Region: 49-260
Classification Level Classification E-value
Superfamily Lysozyme-like 3.37e-69
Family PBP transglycosylase domain-like 0.00000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297584844|ref|YP_003700624.1|
Sequence length 619
Comment glycosyl transferase family 51 protein [Bacillus selenitireducens MLS10]
Sequence
MRLFTGTMFTLLLSSLFAFLFMQVSKEFTHIEHVASSLEERISLDDVRLHNNSYMLDANG
DVISDVYAAENRILIAFEAIPETLINLLLATEDRNYFDHPGFDVTGISRALFVNLQSDGI
EQGGSTITQQVARNLYLTHDQTYDRKITELLYAYQMEQEFDKEDILTLYFNTIYFANGVY
GIEAASRYYFDKTAEELSIAEGAFLLAIPNNPSYYNPLQYKERTETRQKRFISNLHTEGH
IDEATANAAMEESVTLVPSQKTDEFPDYVTYVYDELKELIAYAEGFNRRIRSAGQEERAR
IQEQLNSRVDDLLREGAVIETALDPELQRSVVTSMNNRLRGRGYQGAFALINHHTKELKA
ITGGYNYSKFDFHRGHRAYRQPGSAFKPLLVYGPLLEETRLTPSSVIDAGPIERNGYSPI
NFAGAVYGNDSVRNAFMKSYNTAAVRMLDMIGVETGFEYVEQLGFSELVPEDCRLPSALG
GLTRGTNVLEMTRAFSVFQTDGAYTPARAIRSVTSVDGELLYEWDDNARQVFSPDTARQM
RSLMESVVTDGTANRLQYNLGNYVGGKTGTSNDFHDLWFVGSTDTYTAGVWAGYDSPASL
EATPSVHLDLWGYVMRNLP
Download sequence
Identical sequences D6XXL6
WP_013173480.1.4048 gi|297584844|ref|YP_003700624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]