SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297585212|ref|YP_003700992.1| from Bacillus selenitireducens MLS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297585212|ref|YP_003700992.1|
Domain Number 1 Region: 29-344
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.19e-108
Family Glutaminase 0.00000000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297585212|ref|YP_003700992.1|
Sequence length 344
Comment glutaminase [Bacillus selenitireducens MLS10]
Sequence
MTKKETIIFDDDAFEEGGFEDTLTITDQRDQTYLDEWIAYYRDYAREGASATYIPALAEA
DASQLGIVMARPDGTMLKAGDHDVPFTLQSISKVISFIQVCLDYGISEVLEKVDVEPTGD
AFNSILRLELHKPGRPFNPMINAGALTVASMLCERTPEGKVSSTLDLLEAMLGKRPGINE
QVFESEWETAHRNRAMAYYLKENGFLDCPVEDALNVYLKACSIEVHTEDIAKIGLILAYD
GYDPVTDQRHFPIEVARLTKALMVTCGMYNASGKFAARVGLPSKSGVSGGIMTVVSERAG
SRYSPVPHGGGIGVFGPAIDDYGNSIGGSLLLAQLAKDWDLNIF
Download sequence
Identical sequences D6XZS5
gi|297585212|ref|YP_003700992.1| WP_013173839.1.4048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]