SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478474252|ref|YP_007730328.1| from Chlamydia trachomatis F/SotonF3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478474252|ref|YP_007730328.1|
Domain Number 1 Region: 6-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.53e-44
Family Phosphate binding protein-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478474252|ref|YP_007730328.1|
Sequence length 257
Comment putative ABC transporter arginine-biding protein [Chlamydia trachomatis F/SotonF3]
Sequence
MCIKRKKTWIAFLAVVCSFCLTGCLKEGGDSNSEKFIVGTNATYPPFEFVDKRGEVVGFD
IDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEE
IKHLVLVFKGENKHPLPLTQYRSVAVQTGTYQEAYLQSLSEVHIRSFDSTLEVLMEVMHG
KSPVAVLEPSIAQVVLKDFPALSTATIDLPEDQWVLGYGIGVASDRPALALKIEAAVQEI
RKEGVLAELEQKWGLNN
Download sequence
Identical sequences A0A0E9DGB7 O84385
gi|385239896|ref|YP_005807738.1| gi|527322889|ref|YP_008349086.1| gi|478474252|ref|YP_007730328.1| 272561.CT381 gi|389858073|ref|YP_006360315.1| gi|385242673|ref|YP_005810512.1| NP_219890.1.57406 WP_009871733.1.100466 WP_009871733.1.100644 WP_009871733.1.101362 WP_009871733.1.102133 WP_009871733.1.11717 WP_009871733.1.13674 WP_009871733.1.14786 WP_009871733.1.14984 WP_009871733.1.20093 WP_009871733.1.30792 WP_009871733.1.34934 WP_009871733.1.37956 WP_009871733.1.38504 WP_009871733.1.38813 WP_009871733.1.40272 WP_009871733.1.4187 WP_009871733.1.4264 WP_009871733.1.5036 WP_009871733.1.52091 WP_009871733.1.55117 WP_009871733.1.57520 WP_009871733.1.60937 WP_009871733.1.62239 WP_009871733.1.65391 WP_009871733.1.66489 WP_009871733.1.67250 WP_009871733.1.69355 WP_009871733.1.71619 WP_009871733.1.72034 WP_009871733.1.72442 WP_009871733.1.74323 WP_009871733.1.74635 WP_009871733.1.75470 WP_009871733.1.77153 WP_009871733.1.77651 WP_009871733.1.86066 WP_009871733.1.87079 WP_009871733.1.88937 WP_009871733.1.93216 WP_009871733.1.9343 WP_009871733.1.96955 WP_009871733.1.97602 gi|478475155|ref|YP_007724824.1| gi|478457124|ref|YP_007725717.1| gi|389859825|ref|YP_006362065.1| gi|478460740|ref|YP_007735691.1| gi|478459837|ref|YP_007733905.1| gi|385240819|ref|YP_005808660.1| gi|478455315|ref|YP_007727505.1| gi|15605105|ref|NP_219890.1| gi|385246282|ref|YP_005815104.1| gi|478458034|ref|YP_007731219.1| gi|527320081|ref|YP_008346281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]