SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297584887|ref|YP_003700667.1| from Bacillus selenitireducens MLS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297584887|ref|YP_003700667.1|
Domain Number 1 Region: 312-588
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.59e-66
Family DegV-like 0.00012
Further Details:      
 
Domain Number 2 Region: 2-197
Classification Level Classification E-value
Superfamily DhaL-like 7.98e-31
Family DhaL-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297584887|ref|YP_003700667.1|
Sequence length 598
Comment DegV family protein [Bacillus selenitireducens MLS10]
Sequence
MEMLNHRQFYDMLMSGAHEIIHHQKELNDINVFPVADGDTGNNLAYLMETIIRETRWTDP
SVKTLEDVKQACMRGSRGNSGMIFSQFIISMCNYLIRHDEVAATPFLDMCDASVDSAVGA
VSDPKEGTVLTVMQAWVSSMKEEHHHTSNIEHLLQKSYAITEAAMEKTKTQMEVFRINDV
VDAGAKGFVHFLDGLIKRQEVPERKEGEAPALFVDETVHAMKETDEIPFRYCSEYLVELN
PHESIDTLRQSMSEYGDSIVLVSDNQLGKVHIHTNDPADIADMLVQKGKVVYQKVEDMRR
QYESIYRRKSPIAFVVDSACDLPKELFDHHQIHMIPLNLEVESSNYLDKVTLDAERFYEI
LDAGTTQPKSSQPSLLSVETLYKSLLQQYDSVISLHVSQKLSGTFDVCKKAAEQVDPSRI
HVVNSRTLSGAFGLLAYETAADIEAGKSFEEVKEALYQRIARSEILVSVKNLKHMIRGGR
VSPLQGKVARLLNMKPIVSVDGDGNSLLYGKTFFSSSSVGKMFKQVEAIHSRHGVKSYVL
LNAGAPEAMADCEANMKRITGQEPLYTTSVSPVIGGNAGKGAISVAMMLNEDNARGGA
Download sequence
Identical sequences D6XXQ9
WP_013173523.1.4048 gi|297584887|ref|YP_003700667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]