SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296500908|ref|YP_003662608.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296500908|ref|YP_003662608.1|
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.49e-18
Family SinR domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296500908|ref|YP_003662608.1|
Sequence length 67
Comment XRE family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSPSQDFVVEVAKALNVS
IEELMPK
Download sequence
Identical sequences A0A0D1PLC2 A0A0G4DA93 A0A0G8F4B6 A0A0T7JTT0 A0A142G9V0 A0A1M6R6L5 A0A1Q9L1I4 A0A226QSU0 A0A229M1D5 A0A243DF43 A0A243DWM7 A0A243HVZ1 A0A243KRQ5 A0A243LHJ3 A0A243NBS2 B7HJ14 C2R234 C2SUX9 C2U7Z1 C3DXI5 C3GV50 J8D958 J8HBV1 J8J8A1 J8JKH3 J8KMB2 J8LME4 J8MCU4 N1LDP5 Q81J72 R8G9I3 R8UTL8
gi|30018346|ref|NP_829977.1| NP_829977.1.86172 WP_000387031.1.100082 WP_000387031.1.10055 WP_000387031.1.100912 WP_000387031.1.101127 WP_000387031.1.10584 WP_000387031.1.13498 WP_000387031.1.1354 WP_000387031.1.14006 WP_000387031.1.14039 WP_000387031.1.14174 WP_000387031.1.14176 WP_000387031.1.18914 WP_000387031.1.19438 WP_000387031.1.20208 WP_000387031.1.20651 WP_000387031.1.21055 WP_000387031.1.21675 WP_000387031.1.2251 WP_000387031.1.22699 WP_000387031.1.23540 WP_000387031.1.23652 WP_000387031.1.24680 WP_000387031.1.25290 WP_000387031.1.25599 WP_000387031.1.26513 WP_000387031.1.26637 WP_000387031.1.26826 WP_000387031.1.28237 WP_000387031.1.32784 WP_000387031.1.32927 WP_000387031.1.33201 WP_000387031.1.33717 WP_000387031.1.36221 WP_000387031.1.3798 WP_000387031.1.38345 WP_000387031.1.39957 WP_000387031.1.41464 WP_000387031.1.41518 WP_000387031.1.43434 WP_000387031.1.44956 WP_000387031.1.45109 WP_000387031.1.45317 WP_000387031.1.46326 WP_000387031.1.47975 WP_000387031.1.4964 WP_000387031.1.5025 WP_000387031.1.51072 WP_000387031.1.54116 WP_000387031.1.54240 WP_000387031.1.54736 WP_000387031.1.55116 WP_000387031.1.58822 WP_000387031.1.59058 WP_000387031.1.59997 WP_000387031.1.60153 WP_000387031.1.60334 WP_000387031.1.6304 WP_000387031.1.63902 WP_000387031.1.64282 WP_000387031.1.64568 WP_000387031.1.67001 WP_000387031.1.67873 WP_000387031.1.67912 WP_000387031.1.6846 WP_000387031.1.68562 WP_000387031.1.71114 WP_000387031.1.73396 WP_000387031.1.73457 WP_000387031.1.73594 WP_000387031.1.73790 WP_000387031.1.7544 WP_000387031.1.7593 WP_000387031.1.76086 WP_000387031.1.76155 WP_000387031.1.76804 WP_000387031.1.76902 WP_000387031.1.80126 WP_000387031.1.80649 WP_000387031.1.81773 WP_000387031.1.85348 WP_000387031.1.85592 WP_000387031.1.86619 WP_000387031.1.86637 WP_000387031.1.87768 WP_000387031.1.87873 WP_000387031.1.88154 WP_000387031.1.88200 WP_000387031.1.90352 WP_000387031.1.93683 WP_000387031.1.95576 WP_000387031.1.96287 WP_000387031.1.96437 WP_000387031.1.97262 WP_000387031.1.97327 WP_000387031.1.97670 WP_000387031.1.97842 WP_000387031.1.98053 WP_000387031.1.98604 WP_000387031.1.99212 gi|218235456|ref|YP_002364925.1| 226900.BC0082 405532.BCB4264_A0082 gi|296500908|ref|YP_003662608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]