SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501030|ref|YP_003662730.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501030|ref|YP_003662730.1|
Domain Number 1 Region: 61-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.14e-61
Family L-arabinose binding protein-like 0.0000341
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.55e-18
Family GalR/LacI-like bacterial regulator 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296501030|ref|YP_003662730.1|
Sequence length 325
Comment LacI family transcription regulator [Bacillus thuringiensis BMB171]
Sequence
MANIKDIAKMAGVSVTTVSRVLNDHPYVSEEKRKAVIEIVEKLNYSQNANAVHLSKGKTN
IVGVILPYINHPCFDAMVSGMMETALAHNYRVLLCQTNYNKKEEMKSLHMLKTKQLDGLI
ICSRANDWETIEPYASYGAIIACEDNDISNISSVYTNHSAAFQLGMDYLIEKGYKKIGYC
TGRKLGPSSQKRFDVYKQQLQSIDEEVNEEWIFTECFTLEDGVKVAHKLKEMQDLPEALI
VAGDEVAIGVMTEVEKLGIQVPEDLAIIGFDNQPISQVLQLTTIDQNLKEIGKTAFEMLH
RKVNDESSEQEKLEIPYELVERSTV
Download sequence
Identical sequences A0A0D1NPR5 A0A0F6J1A4 A0A0G4D9J5 A0A0K0S1V1 A0A0Q9G585 A0A0Q9GIM0 A0A160L5U4 A0A164RZW5 A0A1C9BLT3 A0A1I4NJ44 A0A1M7L8I1 A0A1Q9L004 A0A1W6WGJ8 A0A242Y282 A0A242ZU53 A0A243AQX2 A0A243DCN9 A0A243DY32 A0A243EI69 A0A243L8K9 A0A2A2NYI1 A0A2A9HWA1 C2NT74 C2SV99 C2U8A7 C3DE27 C3DXV6 J3U5K6 J7VG68 J7ZTZ0 J8HJF5 J8HM83 J8LF21 J8N0K2 J8P5S3 J8QDP2 J8YWX9 M1PEB3 Q3F0T6 Q81IW5 R8BZ33 R8DH47 R8FEY0 R8G3I8 R8GHI7 R8GSP4 R8I7V0 R8KNV2 R8SZ64 R8XN26 S3J8I0
gi|452196575|ref|YP_007476656.1| NP_830098.1.86172 WP_001273903.1.100497 WP_001273903.1.101838 WP_001273903.1.10584 WP_001273903.1.11442 WP_001273903.1.11521 WP_001273903.1.12935 WP_001273903.1.13269 WP_001273903.1.1354 WP_001273903.1.13975 WP_001273903.1.14006 WP_001273903.1.14174 WP_001273903.1.17374 WP_001273903.1.18914 WP_001273903.1.20651 WP_001273903.1.22084 WP_001273903.1.22152 WP_001273903.1.22699 WP_001273903.1.23245 WP_001273903.1.23360 WP_001273903.1.23540 WP_001273903.1.24680 WP_001273903.1.25290 WP_001273903.1.26459 WP_001273903.1.26483 WP_001273903.1.26513 WP_001273903.1.26637 WP_001273903.1.26826 WP_001273903.1.27446 WP_001273903.1.28237 WP_001273903.1.28599 WP_001273903.1.32784 WP_001273903.1.33201 WP_001273903.1.33717 WP_001273903.1.33790 WP_001273903.1.34061 WP_001273903.1.34537 WP_001273903.1.3546 WP_001273903.1.35694 WP_001273903.1.36221 WP_001273903.1.38325 WP_001273903.1.38345 WP_001273903.1.3925 WP_001273903.1.40818 WP_001273903.1.41090 WP_001273903.1.41518 WP_001273903.1.44956 WP_001273903.1.46326 WP_001273903.1.4964 WP_001273903.1.5025 WP_001273903.1.51681 WP_001273903.1.52284 WP_001273903.1.54547 WP_001273903.1.54736 WP_001273903.1.56320 WP_001273903.1.57561 WP_001273903.1.58712 WP_001273903.1.58822 WP_001273903.1.5895 WP_001273903.1.59058 WP_001273903.1.59384 WP_001273903.1.59997 WP_001273903.1.60153 WP_001273903.1.60255 WP_001273903.1.60526 WP_001273903.1.61243 WP_001273903.1.62277 WP_001273903.1.64282 WP_001273903.1.64421 WP_001273903.1.64568 WP_001273903.1.65803 WP_001273903.1.6816 WP_001273903.1.68562 WP_001273903.1.69347 WP_001273903.1.70108 WP_001273903.1.70667 WP_001273903.1.71114 WP_001273903.1.71242 WP_001273903.1.71652 WP_001273903.1.72484 WP_001273903.1.72752 WP_001273903.1.73790 WP_001273903.1.7534 WP_001273903.1.75891 WP_001273903.1.76902 WP_001273903.1.77402 WP_001273903.1.77567 WP_001273903.1.79549 WP_001273903.1.80622 WP_001273903.1.80649 WP_001273903.1.84541 WP_001273903.1.84775 WP_001273903.1.85667 WP_001273903.1.8577 WP_001273903.1.86637 WP_001273903.1.86763 WP_001273903.1.87705 WP_001273903.1.87768 WP_001273903.1.89145 WP_001273903.1.90452 WP_001273903.1.91020 WP_001273903.1.91367 WP_001273903.1.93683 WP_001273903.1.93838 WP_001273903.1.94914 WP_001273903.1.9533 WP_001273903.1.96272 WP_001273903.1.9700 WP_001273903.1.97262 WP_001273903.1.97816 WP_001273903.1.97821 WP_001273903.1.97830 WP_001273903.1.97842 WP_001273903.1.97993 WP_001273903.1.98604 226900.BC0230 gi|30018467|ref|NP_830098.1| gi|384184283|ref|YP_005570179.1| gi|402562707|ref|YP_006605431.1| gi|296501030|ref|YP_003662730.1| gi|410672569|ref|YP_006924940.1| gi|434378845|ref|YP_006613489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]