SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501258|ref|YP_003662958.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501258|ref|YP_003662958.1|
Domain Number 1 Region: 7-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000676
Family Probable transcriptional regulator VC1968, N-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296501258|ref|YP_003662958.1|
Sequence length 217
Comment transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MPKENPNERLSRLIKKLLKERALSMRQLGMLTNIDPATISRIMNGKQPPKQKHLQKFAEC
LQVPPQLLFDEMYPDSPHINKEKTDMYTSLDTIQQTLQSSNLFDFDYTTTRVKQELENYE
RYAQTTEGEKRIHDSFASKLEQIDSAGPFIEQLTDMYQQFCNETISKEERAVLGSALLYF
ILSTDIIPDYLFPIGYLDDAIAVELAKEKLIELKRKT
Download sequence
Identical sequences A0A0T8ML79 A0A164TFL0 A0A1M6N9R9 A0A229M9X2 A0A2C9YTX1 C2SVV7 J8MGW4 J8P264 Q81IB7
APC38901 gi|30018683|ref|NP_830314.1| 226900.BC0477 NP_830314.1.86172 WP_001123715.1.14006 WP_001123715.1.14176 WP_001123715.1.19438 WP_001123715.1.20208 WP_001123715.1.25599 WP_001123715.1.26513 WP_001123715.1.26637 WP_001123715.1.28237 WP_001123715.1.32784 WP_001123715.1.32927 WP_001123715.1.41464 WP_001123715.1.41518 WP_001123715.1.4964 WP_001123715.1.54736 WP_001123715.1.55116 WP_001123715.1.58822 WP_001123715.1.59058 WP_001123715.1.59997 WP_001123715.1.6304 WP_001123715.1.64282 WP_001123715.1.64568 WP_001123715.1.67001 WP_001123715.1.67912 WP_001123715.1.6846 WP_001123715.1.71114 WP_001123715.1.76155 WP_001123715.1.76902 WP_001123715.1.85592 WP_001123715.1.86637 WP_001123715.1.88200 WP_001123715.1.96437 gi|296501258|ref|YP_003662958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]