SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501421|ref|YP_003663121.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501421|ref|YP_003663121.1|
Domain Number 1 Region: 33-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.6e-91
Family L-arabinose binding protein-like 0.0000000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296501421|ref|YP_003663121.1|
Sequence length 308
Comment catabolite control protein A [Bacillus thuringiensis BMB171]
Sequence
MKKWLLILVACIMVITAGCSMEPPEWAKDSSDKGRNKTIKVGFSVSTLNNPFFVTLKKGA
EKKAKDSGIELIAVDAQNDAAKQTNDVEDLIQKGVDVVVINPTDSDAVASAVSAANAANV
PVITVDRVANSGKVVSHIASNNIEGGQMASDYIRELVGEGANVAELEGIPGSSAARERGK
GFHNVADKSLKVVAKQAADFDRAKGLSVMENILQANSDIKAVFAHNDEMALGALEALKSA
GKTDVVVVGFDATEDAVKAVNDGRMAATVAQKPELIGEKAMQTAKEITQGKKVDKSIPIE
LELIKKNK
Download sequence
Identical sequences A0A0D0RMG3 A0A0D0RQW1 A0A0G4D6H7 A0A0K0Q7T5 A0A0U0J2R0 A0A136CTC3 A0A1J9ZE95 A0A1M6NQL0 A0A1Q9KVY1 A0A226QXC4 A0A229M900 A0A243BG96 A0A243DYU5 A0A243J104 A0A243K4Y5 A0A243LQE5 A0A243LWE1 A0A2H3QID3 J3U4X9 J8FMX9 J8GDT1 J8HI58 J8LDR7 J8N1S2 J8P523 R8C0J2 R8GYH7 R8ID81 R8SPL3
WP_000758976.1.100497 WP_000758976.1.100912 WP_000758976.1.101843 WP_000758976.1.12935 WP_000758976.1.13269 WP_000758976.1.13498 WP_000758976.1.1354 WP_000758976.1.14174 WP_000758976.1.14176 WP_000758976.1.16199 WP_000758976.1.17797 WP_000758976.1.19438 WP_000758976.1.20208 WP_000758976.1.20651 WP_000758976.1.21055 WP_000758976.1.21172 WP_000758976.1.21643 WP_000758976.1.22084 WP_000758976.1.22699 WP_000758976.1.23297 WP_000758976.1.24680 WP_000758976.1.25290 WP_000758976.1.25599 WP_000758976.1.26513 WP_000758976.1.26637 WP_000758976.1.27446 WP_000758976.1.28237 WP_000758976.1.28599 WP_000758976.1.32784 WP_000758976.1.32927 WP_000758976.1.33201 WP_000758976.1.33717 WP_000758976.1.34125 WP_000758976.1.35769 WP_000758976.1.36279 WP_000758976.1.38345 WP_000758976.1.38425 WP_000758976.1.41464 WP_000758976.1.41518 WP_000758976.1.41976 WP_000758976.1.43434 WP_000758976.1.4355 WP_000758976.1.44348 WP_000758976.1.44956 WP_000758976.1.46326 WP_000758976.1.47441 WP_000758976.1.48010 WP_000758976.1.48759 WP_000758976.1.49056 WP_000758976.1.50042 WP_000758976.1.5025 WP_000758976.1.51072 WP_000758976.1.54240 WP_000758976.1.54736 WP_000758976.1.55116 WP_000758976.1.5628 WP_000758976.1.56320 WP_000758976.1.58328 WP_000758976.1.58712 WP_000758976.1.58822 WP_000758976.1.59997 WP_000758976.1.60153 WP_000758976.1.6241 WP_000758976.1.6304 WP_000758976.1.63789 WP_000758976.1.64282 WP_000758976.1.64568 WP_000758976.1.65803 WP_000758976.1.67001 WP_000758976.1.67912 WP_000758976.1.6846 WP_000758976.1.70667 WP_000758976.1.71114 WP_000758976.1.73396 WP_000758976.1.73638 WP_000758976.1.73790 WP_000758976.1.74651 WP_000758976.1.75866 WP_000758976.1.76902 WP_000758976.1.79252 WP_000758976.1.79687 WP_000758976.1.80126 WP_000758976.1.80649 WP_000758976.1.80955 WP_000758976.1.82421 WP_000758976.1.83070 WP_000758976.1.83666 WP_000758976.1.84614 WP_000758976.1.85592 WP_000758976.1.86637 WP_000758976.1.87649 WP_000758976.1.87768 WP_000758976.1.87873 WP_000758976.1.88154 WP_000758976.1.88200 WP_000758976.1.88269 WP_000758976.1.89145 WP_000758976.1.91080 WP_000758976.1.92555 WP_000758976.1.93683 WP_000758976.1.96437 WP_000758976.1.9703 WP_000758976.1.97262 WP_000758976.1.97842 WP_000758976.1.97993 WP_000758976.1.99636 gi|402562307|ref|YP_006605031.1| gi|296501421|ref|YP_003663121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]