SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501499|ref|YP_003663199.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501499|ref|YP_003663199.1|
Domain Number 1 Region: 59-311
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.75e-62
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000154
Family GalR/LacI-like bacterial regulator 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296501499|ref|YP_003663199.1|
Sequence length 328
Comment sucrose operon repressor [Bacillus thuringiensis BMB171]
Sequence
MAKTIADIAKLAGVAKSTVSRYLNGGYVSDKTKLKIEGIIQETNFSPNTFAQSLKAKTTN
LIGVIIPRLDSFATMKTLIGIDKTLQENNYQMLVANANQTTGTEIQAIENFIKQKVAGII
LLTKTLTNEHQKIMANSNIPILFVGQEYKDQYCLVHDDYDAAYELGAYVLSQGHRHIAYL
GIEKDDISVGINRKNGFQKAIENLEPTCNVSYYETTFRIEDAMKQVQHILDNNCPTLIVC
ATDNIALGAMKVIHSHSLSVPGDISVTGFGGYDISEMVHPSLTTIAFDYEYAGKLAATSL
SQLVENKTIPKILHSRYTLKIQESVDKI
Download sequence
Identical sequences A0A0T8JF78 A0A1M6P358 A0A1Y0TZN1 A0A1Y5ZS64 A0A229MCZ5 A0A243DUM2 R8GXM3
WP_001140401.1.100912 WP_001140401.1.14176 WP_001140401.1.19438 WP_001140401.1.20208 WP_001140401.1.25599 WP_001140401.1.32927 WP_001140401.1.33201 WP_001140401.1.41464 WP_001140401.1.41518 WP_001140401.1.51072 WP_001140401.1.55116 WP_001140401.1.60153 WP_001140401.1.67001 WP_001140401.1.67912 WP_001140401.1.6846 WP_001140401.1.68562 WP_001140401.1.71114 WP_001140401.1.73396 WP_001140401.1.80126 WP_001140401.1.85592 WP_001140401.1.88200 WP_001140401.1.96437 gi|296501499|ref|YP_003663199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]