SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501634|ref|YP_003663334.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501634|ref|YP_003663334.1|
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.21e-17
Family SinR domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296501634|ref|YP_003663334.1|
Sequence length 65
Comment PbsX family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MSVSKIKIARTEKGLTQQELAVLVNVTRQTIGLIELNKYNPSLKLCIDIAKSLDKTLDEL
FWEEK
Download sequence
Identical sequences A0A0J1HUR7 A0A0J7H4I5 A0A0K0SJ40 A0A1D3QTG8 A0A243E1Q8 A0A2B3KKW0 B3Z308 B7HEZ4 R8M7B8
gi|296501634|ref|YP_003663334.1| gi|296506639|ref|YP_003667873.1| 405532.BCB4264_A0957 gi|296506639|ref|YP_003667873.1|NC_014172 gi|218235301|ref|YP_002365690.1| WP_000116561.1.14176 WP_000116561.1.17424 WP_000116561.1.19438 WP_000116561.1.33299 WP_000116561.1.36161 WP_000116561.1.42182 WP_000116561.1.43914 WP_000116561.1.44956 WP_000116561.1.47975 WP_000116561.1.57732 WP_000116561.1.60153 WP_000116561.1.61991 WP_000116561.1.71811 WP_000116561.1.72484 WP_000116561.1.779 WP_000116561.1.7885 WP_000116561.1.90254 WP_000116561.1.94373 WP_000116561.1.95576 WP_000116561.1.96647 WP_000116561.1.97149 WP_000116561.1.99454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]