SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501701|ref|YP_003663401.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501701|ref|YP_003663401.1|
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000648
Family SinR domain-like 0.059
Further Details:      
 
Domain Number 2 Region: 113-273
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000118
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296501701|ref|YP_003663401.1|
Sequence length 297
Comment XRE family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MEFNDLGITIKELRIKKNISQSELCYGICSQSQISKIEKGMIYPSSILLYQLSERLGIDP
NNIFALTQNKRLKYVENVKYVIKDCLKQKQYKELYEIVKKEKNLNNFQTKDEKQFLIWHE
AIAIFMVDKSIKTALDFLNNALKLTLTNSDFLSEREIDIMQTMAIFYAENKEYEKSINIF
KKCLTNFNKLDFPRDKEIKLKLMLNLAKCFDFTYQHEEAIKYIDKGIKLAINLNTLYLLG
ELFYLKGQCLLKMKQHNVEDVIYNWKKALFIFELTEKEYYTKMLPDELIEIQNKKHS
Download sequence
Identical sequences A0A243DPF9
WP_000395487.1.41518 WP_000395487.1.71114 gi|296501701|ref|YP_003663401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]