SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501792|ref|YP_003663492.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501792|ref|YP_003663492.1|
Domain Number 1 Region: 60-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.07e-72
Family L-arabinose binding protein-like 0.0000166
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.51e-17
Family GalR/LacI-like bacterial regulator 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296501792|ref|YP_003663492.1|
Sequence length 337
Comment LacI family transcription regulator [Bacillus thuringiensis BMB171]
Sequence
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTE
TIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGII
LCSLENPWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLDQGYRNLIF
CRGNETKVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAI
LAGGDEVAAGIISEAKRHNWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVD
LMMDKIHTKNYRKKELYEFELELLVKGSTMKDKMLLA
Download sequence
Identical sequences A0A023P3R3 A0A0A3VUX8 A0A0D1NEY1 A0A0F6FSD7 A0A0F6JBM6 A0A0G3DYA8 A0A0G4D5C8 A0A0K0S494 A0A0T8DU34 A0A0W7YFW6 A0A135WCB0 A0A193CPL8 A0A1G1UM98 A0A1M6GVF8 A0A1Q9KM54 A0A1W2GUW3 A0A226QZ94 A0A229M4D3 A0A242YZD7 A0A243A8H0 A0A243C7V8 A0A243D3R4 A0A243DPQ6 A0A243EXI6 A0A243HJ26 A0A243ITP0 A0A243JB14 A0A243L9S6 A0A2A2PBI0 A0A2C9ZFG2 B5UHJ3 J7ZUD3 J8HGE2 J8HT27 J8I3G6 J8KCD1 J8LC18 J8LTG9 M1PGQ1 N1LL56 R8EZB3 R8HB87 R8N1W8 R8QH60 R8UBX2 W8Y7P7
gi|452197430|ref|YP_007477511.1| WP_000103715.1.100082 WP_000103715.1.10055 WP_000103715.1.100912 WP_000103715.1.101224 WP_000103715.1.10584 WP_000103715.1.10745 WP_000103715.1.10845 WP_000103715.1.1112 WP_000103715.1.11442 WP_000103715.1.12553 WP_000103715.1.13498 WP_000103715.1.1354 WP_000103715.1.13975 WP_000103715.1.14006 WP_000103715.1.14174 WP_000103715.1.14176 WP_000103715.1.17374 WP_000103715.1.18749 WP_000103715.1.18914 WP_000103715.1.19438 WP_000103715.1.19516 WP_000103715.1.20208 WP_000103715.1.20651 WP_000103715.1.21055 WP_000103715.1.2206 WP_000103715.1.2251 WP_000103715.1.22699 WP_000103715.1.23245 WP_000103715.1.23307 WP_000103715.1.23360 WP_000103715.1.23540 WP_000103715.1.23652 WP_000103715.1.24680 WP_000103715.1.24795 WP_000103715.1.25290 WP_000103715.1.25599 WP_000103715.1.26483 WP_000103715.1.26513 WP_000103715.1.26637 WP_000103715.1.26826 WP_000103715.1.26872 WP_000103715.1.26965 WP_000103715.1.27106 WP_000103715.1.27931 WP_000103715.1.29836 WP_000103715.1.29993 WP_000103715.1.31221 WP_000103715.1.3180 WP_000103715.1.32927 WP_000103715.1.33201 WP_000103715.1.33717 WP_000103715.1.33790 WP_000103715.1.34175 WP_000103715.1.34587 WP_000103715.1.35694 WP_000103715.1.36221 WP_000103715.1.37239 WP_000103715.1.3798 WP_000103715.1.38345 WP_000103715.1.38427 WP_000103715.1.38591 WP_000103715.1.39411 WP_000103715.1.39957 WP_000103715.1.40034 WP_000103715.1.40430 WP_000103715.1.41090 WP_000103715.1.41464 WP_000103715.1.41518 WP_000103715.1.4185 WP_000103715.1.41879 WP_000103715.1.42167 WP_000103715.1.42218 WP_000103715.1.43434 WP_000103715.1.43767 WP_000103715.1.44348 WP_000103715.1.44497 WP_000103715.1.44956 WP_000103715.1.45317 WP_000103715.1.45720 WP_000103715.1.47000 WP_000103715.1.47437 WP_000103715.1.47975 WP_000103715.1.49455 WP_000103715.1.49702 WP_000103715.1.5025 WP_000103715.1.50694 WP_000103715.1.51047 WP_000103715.1.51072 WP_000103715.1.51681 WP_000103715.1.54116 WP_000103715.1.54142 WP_000103715.1.54240 WP_000103715.1.54736 WP_000103715.1.54777 WP_000103715.1.55116 WP_000103715.1.5543 WP_000103715.1.57561 WP_000103715.1.57732 WP_000103715.1.58586 WP_000103715.1.58632 WP_000103715.1.58822 WP_000103715.1.5895 WP_000103715.1.59058 WP_000103715.1.59997 WP_000103715.1.60153 WP_000103715.1.60334 WP_000103715.1.61243 WP_000103715.1.62277 WP_000103715.1.62770 WP_000103715.1.6304 WP_000103715.1.63743 WP_000103715.1.63789 WP_000103715.1.63902 WP_000103715.1.64568 WP_000103715.1.6475 WP_000103715.1.64764 WP_000103715.1.66999 WP_000103715.1.67001 WP_000103715.1.674 WP_000103715.1.6743 WP_000103715.1.67873 WP_000103715.1.67912 WP_000103715.1.68007 WP_000103715.1.6816 WP_000103715.1.68346 WP_000103715.1.6846 WP_000103715.1.68562 WP_000103715.1.69501 WP_000103715.1.70181 WP_000103715.1.71114 WP_000103715.1.71242 WP_000103715.1.71652 WP_000103715.1.72484 WP_000103715.1.73396 WP_000103715.1.73594 WP_000103715.1.73790 WP_000103715.1.74302 WP_000103715.1.74372 WP_000103715.1.74832 WP_000103715.1.74857 WP_000103715.1.74976 WP_000103715.1.7534 WP_000103715.1.7544 WP_000103715.1.75866 WP_000103715.1.7593 WP_000103715.1.76155 WP_000103715.1.76804 WP_000103715.1.76902 WP_000103715.1.77386 WP_000103715.1.77567 WP_000103715.1.80126 WP_000103715.1.80622 WP_000103715.1.80649 WP_000103715.1.81000 WP_000103715.1.81570 WP_000103715.1.83694 WP_000103715.1.83977 WP_000103715.1.84541 WP_000103715.1.84775 WP_000103715.1.85348 WP_000103715.1.85592 WP_000103715.1.8577 WP_000103715.1.85928 WP_000103715.1.86637 WP_000103715.1.869 WP_000103715.1.87013 WP_000103715.1.87725 WP_000103715.1.87768 WP_000103715.1.87777 WP_000103715.1.88200 WP_000103715.1.88269 WP_000103715.1.89009 WP_000103715.1.90254 WP_000103715.1.90352 WP_000103715.1.90466 WP_000103715.1.90665 WP_000103715.1.91020 WP_000103715.1.93683 WP_000103715.1.95576 WP_000103715.1.9623 WP_000103715.1.96287 WP_000103715.1.96437 WP_000103715.1.9700 WP_000103715.1.97082 WP_000103715.1.97262 WP_000103715.1.97561 WP_000103715.1.97816 WP_000103715.1.97842 WP_000103715.1.97993 WP_000103715.1.98053 WP_000103715.1.9860 WP_000103715.1.98604 WP_000103715.1.99212 WP_000103715.1.99636 gi|384185119|ref|YP_005571015.1| gi|410673412|ref|YP_006925783.1| gi|296501792|ref|YP_003663492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]