SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501947|ref|YP_003663647.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501947|ref|YP_003663647.1|
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.29e-18
Family SinR domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296501947|ref|YP_003663647.1|
Sequence length 69
Comment PbsX family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MENKMVEYRKKFGLSQEKLAEKLGVSRQTIISIEKGKYDPSLPLAFEIAKTFQTTIEHVF
IYKGKEEGE
Download sequence
Identical sequences A0A162SP39 A0A229M9K7 A0A243DMQ6 A0A243K091 C2SXY4 J8NNG2 Q81GF1 R8UBG0
NP_831037.1.86172 WP_000428513.1.14039 WP_000428513.1.20208 WP_000428513.1.20651 WP_000428513.1.22699 WP_000428513.1.26637 WP_000428513.1.33201 WP_000428513.1.3798 WP_000428513.1.41518 WP_000428513.1.5025 WP_000428513.1.55116 WP_000428513.1.56320 WP_000428513.1.58822 WP_000428513.1.59997 WP_000428513.1.65803 WP_000428513.1.67001 WP_000428513.1.67912 WP_000428513.1.71114 WP_000428513.1.73457 WP_000428513.1.76902 WP_000428513.1.80649 WP_000428513.1.81773 WP_000428513.1.87768 WP_000428513.1.88154 WP_000428513.1.88200 WP_000428513.1.97670 WP_000428513.1.97842 gi|296501947|ref|YP_003663647.1| 226900.BC1253 gi|30019406|ref|NP_831037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]