SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501962|ref|YP_003663662.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501962|ref|YP_003663662.1|
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 6.48e-19
Family SinR domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 72-106
Classification Level Classification E-value
Superfamily SinR repressor dimerisation domain-like 0.00000000000000994
Family SinR repressor dimerisation domain-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296501962|ref|YP_003663662.1|
Sequence length 107
Comment SinR protein [Bacillus thuringiensis BMB171]
Sequence
MIGERIKRLRLQKGISLTELAEKAGVAKSYISSIERNLQKNPSIQFLEKIAAVLQIPVDT
LLHDETTKETNLDSEWTQLVKDAMNSGVSKEQFREFLEFTKWKQNQK
Download sequence
Identical sequences A0A023P2V6 A0A0A3VUL1 A0A0E8TJ11 A0A0F6FLF7 A0A0G3DUY9 A0A0G4D684 A0A0K0S4S6 A0A135WB81 A0A193CQ29 A0A1C9BQA8 A0A1G1ULP5 A0A1H5V381 A0A1I3ZRG6 A0A1M6H6D5 A0A1M7B6E4 A0A1Q9KLL7 A0A1W2GTN4 A0A226QZX5 A0A229M9S4 A0A242YIJ7 A0A242ZTP4 A0A243C9K5 A0A243DQ94 A0A243EK99 A0A243EY30 A0A243FSZ2 A0A243JBK9 A0A243JJW6 A0A243K055 A0A243LUQ6 A0A2A9I1J6 A0A2C3N9I6 B5UI09 C2NVY4 C2SY12 C2WJI6 C2X8W2 C3GY37 G9QAH7 J7ZQ72 J8GUW4 J8HJJ1 J8KA77 J8LFB1 J8LWL3 J8MV52 J8RMA9 J8Y7K7 Q81GC5 R8ETW7 R8HAL1 R8MSD8 R8QEZ3 S3IU93 W8XZQ6
NP_831064.1.86172 WP_000578885.1.100912 WP_000578885.1.101224 WP_000578885.1.101720 WP_000578885.1.10745 WP_000578885.1.10845 WP_000578885.1.1112 WP_000578885.1.11442 WP_000578885.1.11521 WP_000578885.1.12553 WP_000578885.1.13498 WP_000578885.1.1354 WP_000578885.1.13975 WP_000578885.1.14006 WP_000578885.1.14174 WP_000578885.1.14176 WP_000578885.1.17374 WP_000578885.1.1809 WP_000578885.1.18749 WP_000578885.1.19438 WP_000578885.1.19516 WP_000578885.1.20208 WP_000578885.1.20651 WP_000578885.1.2206 WP_000578885.1.22699 WP_000578885.1.23245 WP_000578885.1.24795 WP_000578885.1.25290 WP_000578885.1.25599 WP_000578885.1.26483 WP_000578885.1.26637 WP_000578885.1.26872 WP_000578885.1.26965 WP_000578885.1.27106 WP_000578885.1.27931 WP_000578885.1.28237 WP_000578885.1.29836 WP_000578885.1.29993 WP_000578885.1.31221 WP_000578885.1.3180 WP_000578885.1.32784 WP_000578885.1.32927 WP_000578885.1.33201 WP_000578885.1.33717 WP_000578885.1.34061 WP_000578885.1.34175 WP_000578885.1.34587 WP_000578885.1.35694 WP_000578885.1.37239 WP_000578885.1.38345 WP_000578885.1.38427 WP_000578885.1.38591 WP_000578885.1.3925 WP_000578885.1.39411 WP_000578885.1.40034 WP_000578885.1.40430 WP_000578885.1.40818 WP_000578885.1.41090 WP_000578885.1.41464 WP_000578885.1.41518 WP_000578885.1.4185 WP_000578885.1.41879 WP_000578885.1.42167 WP_000578885.1.42218 WP_000578885.1.42485 WP_000578885.1.43434 WP_000578885.1.43442 WP_000578885.1.43767 WP_000578885.1.44348 WP_000578885.1.44428 WP_000578885.1.4447 WP_000578885.1.44497 WP_000578885.1.44956 WP_000578885.1.45720 WP_000578885.1.46326 WP_000578885.1.47000 WP_000578885.1.47437 WP_000578885.1.49455 WP_000578885.1.4964 WP_000578885.1.49702 WP_000578885.1.5025 WP_000578885.1.50694 WP_000578885.1.51047 WP_000578885.1.51072 WP_000578885.1.51099 WP_000578885.1.51681 WP_000578885.1.54116 WP_000578885.1.54142 WP_000578885.1.54240 WP_000578885.1.54547 WP_000578885.1.54736 WP_000578885.1.54777 WP_000578885.1.55077 WP_000578885.1.55116 WP_000578885.1.5543 WP_000578885.1.56320 WP_000578885.1.58586 WP_000578885.1.58632 WP_000578885.1.58822 WP_000578885.1.59058 WP_000578885.1.59997 WP_000578885.1.60153 WP_000578885.1.61243 WP_000578885.1.61820 WP_000578885.1.62770 WP_000578885.1.6304 WP_000578885.1.63743 WP_000578885.1.63789 WP_000578885.1.64282 WP_000578885.1.64568 WP_000578885.1.6475 WP_000578885.1.64764 WP_000578885.1.65803 WP_000578885.1.66999 WP_000578885.1.67001 WP_000578885.1.674 WP_000578885.1.6743 WP_000578885.1.67912 WP_000578885.1.68007 WP_000578885.1.6816 WP_000578885.1.68346 WP_000578885.1.6846 WP_000578885.1.68562 WP_000578885.1.69347 WP_000578885.1.69501 WP_000578885.1.70108 WP_000578885.1.70181 WP_000578885.1.71114 WP_000578885.1.71242 WP_000578885.1.72484 WP_000578885.1.72752 WP_000578885.1.73396 WP_000578885.1.73790 WP_000578885.1.74302 WP_000578885.1.74372 WP_000578885.1.74832 WP_000578885.1.74857 WP_000578885.1.74863 WP_000578885.1.74976 WP_000578885.1.7544 WP_000578885.1.75891 WP_000578885.1.75942 WP_000578885.1.76883 WP_000578885.1.76902 WP_000578885.1.77386 WP_000578885.1.77402 WP_000578885.1.77567 WP_000578885.1.80126 WP_000578885.1.80649 WP_000578885.1.81000 WP_000578885.1.83694 WP_000578885.1.83977 WP_000578885.1.84775 WP_000578885.1.85592 WP_000578885.1.85928 WP_000578885.1.86374 WP_000578885.1.86637 WP_000578885.1.86763 WP_000578885.1.869 WP_000578885.1.87013 WP_000578885.1.87725 WP_000578885.1.87768 WP_000578885.1.87777 WP_000578885.1.87873 WP_000578885.1.87947 WP_000578885.1.88154 WP_000578885.1.88200 WP_000578885.1.89009 WP_000578885.1.90254 WP_000578885.1.90452 WP_000578885.1.90466 WP_000578885.1.90665 WP_000578885.1.91367 WP_000578885.1.93683 WP_000578885.1.93838 WP_000578885.1.94308 WP_000578885.1.9533 WP_000578885.1.9623 WP_000578885.1.96272 WP_000578885.1.96437 WP_000578885.1.9700 WP_000578885.1.97082 WP_000578885.1.97262 WP_000578885.1.97327 WP_000578885.1.97561 WP_000578885.1.97816 WP_000578885.1.97842 WP_000578885.1.98053 WP_000578885.1.9860 gi|449088169|ref|YP_007420610.1| gi|296501962|ref|YP_003663662.1| gi|30019433|ref|NP_831064.1| 226900.BC1282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]