SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296502381|ref|YP_003664081.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296502381|ref|YP_003664081.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000045
Family Probable transcriptional regulator VC1968, N-terminal domain 0.074
Further Details:      
 
Domain Number 2 Region: 184-395
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000081
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296502381|ref|YP_003664081.1|
Sequence length 404
Comment XRE family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MATLGEKIKTLRKEKKLTQTDLAGSELTKSMLSQIENGKATPSMKTLQYIADKLECETSF
LLEDDDVEIVELIQQTEKLIKTNKYDEVYEVLLPIVQKELPPTLNTARLYKQFVTAAAKM
KDYNIEYYVEKATSIFEKYTLYRDSTETKLKLSFTIFTRKKYAECLQLIASIRNDYEEKH
LEMDLIIHIELYLYEAIIFLACGDYEQCESVILDALAFSKKHQVYYKTDEFYRILSYQKV
ITADKEQYLHYIKKSEQFAIFTEDNFSAAVIDLLKAFYYNTIANEYTVALEHLEQFREKL
KDEPIFQDDGSYYLEKGKALYGLKQYEEALKTLQRAIIPDYINHPLDHARLTTAGAYRAL
CYVKLNDKKRALEEVTEAYEIVQSYPDSIFTSFIKETLQIIQKL
Download sequence
Identical sequences A0A0D1NGR9 A0A243DYD7 C3E1W3 J8LDU3
WP_000212382.1.18914 WP_000212382.1.23540 WP_000212382.1.36221 WP_000212382.1.41518 WP_000212382.1.71114 gi|296502381|ref|YP_003664081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]