SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296502550|ref|YP_003664250.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296502550|ref|YP_003664250.1|
Domain Number 1 Region: 39-385
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.22e-80
Family L-arabinose binding protein-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296502550|ref|YP_003664250.1|
Sequence length 405
Comment leucine-, isoleucine-, valine-,threonine-, and alanine-binding protein [Bacillus thuringiensis BMB171]
Sequence
MSMKKRKWLKTMFTGCVLGSLLITAACSGKKTSTEDEKTIKVGVLASLTGPLESYGKQTV
NGFELGLDYATGGTGKVDGKKIKFVVEDTETKADVAVKKATKLLEEEKVDFLVGSSSSSD
TLAVLPLAEEYEKIMVVEPAVADSITGKNWNKYIFRTGRSSSQDAIAGAAAIAKKDVKIA
TFAPDNAFGREGIAAFKAGAKKLGANIVNEQYADTNSTDFTANIQNIISSKPDYLFIVWA
GANSPWKQLKDMNVEAQGIKISTGAPDIPALKTMDALVGMQGFSVYYHTLPKNKVNDWLV
EEHKKRFNGAVPDLFTAGGMSAAISIVEALKKTKGDTDVDTLIKKMEGMEFDTPKGKMKF
REKDHQAMQTLYSITLKKQDGVDYPVPVLERELTMKETEPPVQNK
Download sequence
Identical sequences A0A0G4D4A9 A0A0K0QB26 A0A0T8DTJ7 A0A164Z223 A0A1M6LGB3 A0A1Q9KJW6 A0A243DI82 A0A243DXF5 A0A243HT25 A0A243M1Q7 A0A243MJS5 A0A2H3QSE2 B7ISC0 C2SZV9 J7VWC4 J8F7L5 J8M318 J8MV50 J8NM79 Q81EP1 R8DSH8 R8FPG3 R8FS37 R8GJ14 R8KCD3 R8U8K5 R8YG87
gi|218896899|ref|YP_002445310.1| APC24707 NP_831697.1.86172 WP_000061996.1.100082 WP_000061996.1.10584 WP_000061996.1.1354 WP_000061996.1.14006 WP_000061996.1.14039 WP_000061996.1.14176 WP_000061996.1.19438 WP_000061996.1.20651 WP_000061996.1.22084 WP_000061996.1.22152 WP_000061996.1.23652 WP_000061996.1.25290 WP_000061996.1.25599 WP_000061996.1.26513 WP_000061996.1.26637 WP_000061996.1.26826 WP_000061996.1.28237 WP_000061996.1.32784 WP_000061996.1.32927 WP_000061996.1.33201 WP_000061996.1.33717 WP_000061996.1.34537 WP_000061996.1.35769 WP_000061996.1.3798 WP_000061996.1.38345 WP_000061996.1.41464 WP_000061996.1.41518 WP_000061996.1.4355 WP_000061996.1.45317 WP_000061996.1.46326 WP_000061996.1.48759 WP_000061996.1.4964 WP_000061996.1.50042 WP_000061996.1.5025 WP_000061996.1.56320 WP_000061996.1.58822 WP_000061996.1.59058 WP_000061996.1.59384 WP_000061996.1.59997 WP_000061996.1.60255 WP_000061996.1.61799 WP_000061996.1.6304 WP_000061996.1.64282 WP_000061996.1.64568 WP_000061996.1.65803 WP_000061996.1.6846 WP_000061996.1.68562 WP_000061996.1.71114 WP_000061996.1.73457 WP_000061996.1.73594 WP_000061996.1.73790 WP_000061996.1.74651 WP_000061996.1.76804 WP_000061996.1.76902 WP_000061996.1.79549 WP_000061996.1.81773 WP_000061996.1.83666 WP_000061996.1.84614 WP_000061996.1.85592 WP_000061996.1.85667 WP_000061996.1.86637 WP_000061996.1.87768 WP_000061996.1.90352 WP_000061996.1.92555 WP_000061996.1.93683 WP_000061996.1.94914 WP_000061996.1.96437 WP_000061996.1.9703 WP_000061996.1.97262 WP_000061996.1.97670 gi|296502550|ref|YP_003664250.1| gi|30020066|ref|NP_831697.1| 226900.BC1927 405531.BCG9842_B3411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]