SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296502794|ref|YP_003664494.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296502794|ref|YP_003664494.1|
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.15e-18
Family Phage repressors 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296502794|ref|YP_003664494.1|
Sequence length 72
Comment Cro/CI family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MTIIINIDVMLAKRKMSVTELSEKVGITMANLSILKNAKAKAVRFSTLEAICKALECQPG
DILEYKNDENTQ
Download sequence
Identical sequences A0A0G4D1W2 A0A0T8G3L8 A0A162SY13 A0A1M6JNT4 A0A1Q9KNP5 A0A1Y0TFL3 A0A229M672 A0A243K3D4 A0A243L7M5 A0A2C9YSD5 J8EVL5 J8M0Z6 J8MT11 J8N181 R8H8T1
gi|296502794|ref|YP_003664494.1| WP_000152532.1.100912 WP_000152532.1.1354 WP_000152532.1.14006 WP_000152532.1.14174 WP_000152532.1.14176 WP_000152532.1.19438 WP_000152532.1.20208 WP_000152532.1.20651 WP_000152532.1.21055 WP_000152532.1.22699 WP_000152532.1.24680 WP_000152532.1.25290 WP_000152532.1.25599 WP_000152532.1.26513 WP_000152532.1.26637 WP_000152532.1.28237 WP_000152532.1.32784 WP_000152532.1.32927 WP_000152532.1.33717 WP_000152532.1.38345 WP_000152532.1.41464 WP_000152532.1.41518 WP_000152532.1.44956 WP_000152532.1.46326 WP_000152532.1.4964 WP_000152532.1.5025 WP_000152532.1.51072 WP_000152532.1.54240 WP_000152532.1.54736 WP_000152532.1.55116 WP_000152532.1.56320 WP_000152532.1.58822 WP_000152532.1.59997 WP_000152532.1.60153 WP_000152532.1.6304 WP_000152532.1.64282 WP_000152532.1.64568 WP_000152532.1.65803 WP_000152532.1.67001 WP_000152532.1.67912 WP_000152532.1.6846 WP_000152532.1.68562 WP_000152532.1.71114 WP_000152532.1.73396 WP_000152532.1.73790 WP_000152532.1.76155 WP_000152532.1.76902 WP_000152532.1.80126 WP_000152532.1.80649 WP_000152532.1.85592 WP_000152532.1.86637 WP_000152532.1.87768 WP_000152532.1.88154 WP_000152532.1.88200 WP_000152532.1.93683 WP_000152532.1.96437 WP_000152532.1.97262 WP_000152532.1.97842 WP_000152532.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]