SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296502946|ref|YP_003664646.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296502946|ref|YP_003664646.1|
Domain Number 1 Region: 57-184
Classification Level Classification E-value
Superfamily RmlC-like cupins 4.34e-24
Family TM1287-like 0.067
Further Details:      
 
Domain Number 2 Region: 2-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.31e-17
Family SinR domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296502946|ref|YP_003664646.1|
Sequence length 186
Comment MerR family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MIHDRLGQTVLSYRKKNNMTIREFADYAGISTSLISQIERGHANPSLNVLELIAKALNVP
LFTLFINDIDTDSLISKKKDRKKVYRENNDHIVYDVLTPDFMKARIEMLMMDLNKRANTT
ESHYSHEDKEEIAVIMKGEVYVELEGKEYFLEEGDVVRIPPNVKHRFLNKSDESNHILFV
LTPSLG
Download sequence
Identical sequences A0A160HCE4 A0A1M6K319 A0A229MJY1 A0A243DWZ7 A0A2J9D8Q7 J8M1K0 R8H943
gi|296502946|ref|YP_003664646.1| WP_000581031.1.14039 WP_000581031.1.14176 WP_000581031.1.19438 WP_000581031.1.20208 WP_000581031.1.20651 WP_000581031.1.25599 WP_000581031.1.26513 WP_000581031.1.26826 WP_000581031.1.32927 WP_000581031.1.41464 WP_000581031.1.41518 WP_000581031.1.55116 WP_000581031.1.56320 WP_000581031.1.60153 WP_000581031.1.6304 WP_000581031.1.64568 WP_000581031.1.65803 WP_000581031.1.67001 WP_000581031.1.67912 WP_000581031.1.6846 WP_000581031.1.68562 WP_000581031.1.71114 WP_000581031.1.73457 WP_000581031.1.73790 WP_000581031.1.81773 WP_000581031.1.85592 WP_000581031.1.86637 WP_000581031.1.87768 WP_000581031.1.88200 WP_000581031.1.96287 WP_000581031.1.96437 WP_000581031.1.97670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]