SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296503150|ref|YP_003664850.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|296503150|ref|YP_003664850.1|
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000204
Family NE1354 0.087
Further Details:      
 
Domain Number - Region: 237-345
Classification Level Classification E-value
Superfamily TPR-like 0.0069
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296503150|ref|YP_003664850.1|
Sequence length 383
Comment prophage helix-turn-helix protein [Bacillus thuringiensis BMB171]
Sequence
MWKALNQIEKELCAAGIRKNKLADYWGVKPSTVTKIFKGNTDMSFGFLSKTIILLNKGIQ
VQENLLTDYIHITKPKSENLREAMEDLALRGKFNLLINIINSESQSKVAENREFANVYRI
IYRRYIGEIDATQYHKALSLESKSIKTSEMEVLSEILLCQAQYQSGNFTSLNERLKSLEI
KINTISNRYIRECYKLRYKEAIAVTSLQGGEVIEARHVSKELLDDLEWDNFFSFPKVNAY
LKLGESYIFSANEYERAKYYLEKTLEVIGDSKTNGIERKRKMVQHTLSFLKIHHDKEISS
LDVVHSGELAYLRIKQGKKMEARKLLDQLKEKNGRLTDIQTAYLGLTYEGTKKEELMKRS
LLMCQKSGNIFYSNLPKIHLGLI
Download sequence
Identical sequences A0A243DKB3
WP_000265306.1.41518 WP_000265306.1.71114 gi|296503150|ref|YP_003664850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]