SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296503153|ref|YP_003664853.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296503153|ref|YP_003664853.1|
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000198
Family SinR domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296503153|ref|YP_003664853.1|
Sequence length 63
Comment transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MKTLKQLRVEQGYTCREVAEAVGITEVYYWYIENGKRRPYYDLIVKIAEFFKVKLDAIKI
FCP
Download sequence
Identical sequences A0A0D1R0P3 A0A0K0QDR8 A0A193CT19 A0A1C4ETK9 A0A242WDL2 A0A242XRA8 A0A243DMY2 A0A243JXX1 A0A2A2P7A1 A0A2A8KKS2 C3EC92 J8FZN1 J8LLZ1 R8DVD5 R8FLT1 R8FWH9 R8GGH5 R8K8H0 W8YBR6
gi|296503153|ref|YP_003664853.1| WP_000854271.1.11521 WP_000854271.1.18914 WP_000854271.1.22152 WP_000854271.1.23540 WP_000854271.1.27140 WP_000854271.1.31221 WP_000854271.1.35769 WP_000854271.1.36221 WP_000854271.1.41518 WP_000854271.1.42485 WP_000854271.1.47437 WP_000854271.1.51072 WP_000854271.1.54142 WP_000854271.1.54736 WP_000854271.1.55968 WP_000854271.1.60255 WP_000854271.1.60781 WP_000854271.1.62770 WP_000854271.1.62918 WP_000854271.1.6716 WP_000854271.1.67239 WP_000854271.1.70018 WP_000854271.1.71114 WP_000854271.1.73396 WP_000854271.1.74651 WP_000854271.1.7534 WP_000854271.1.7593 WP_000854271.1.79549 WP_000854271.1.80126 WP_000854271.1.85348 WP_000854271.1.85667 WP_000854271.1.85901 WP_000854271.1.86619 WP_000854271.1.88154 WP_000854271.1.89460 WP_000854271.1.94914 WP_000854271.1.96272 WP_000854271.1.96287 WP_000854271.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]