SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296503494|ref|YP_003665194.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296503494|ref|YP_003665194.1|
Domain Number 1 Region: 34-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.93e-80
Family L-arabinose binding protein-like 0.00000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296503494|ref|YP_003665194.1|
Sequence length 347
Comment sugar-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKRKLGIVLIVCICLIGLIACSSQTADKKKVDDVKFAFIPKLTGVGFFTSGGEGAKEMGD
KLGVQVKYDGPSEASVSGQVKYINNFINQNYDAIMVSSTSVDGLSQSLQRAKKKGMTVLT
WDSDVNPKDRSFYISQGTPDQLANLLIEMTSKQIGDKGKVAFFYSSPTVTDQNQWVTKAK
EIIKKKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAMAQAAENL
KMDKKVVVTGFSTPNVMRDYVKRGTVAQFGLWDVKQQGALATYVANEIVVKEKKLKVGDS
FEVKGIGKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF
Download sequence
Identical sequences A0A243DVR5
gi|296503494|ref|YP_003665194.1| WP_000823657.1.41518 WP_000823657.1.71114 WP_000823657.1.86637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]