SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296503519|ref|YP_003665219.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296503519|ref|YP_003665219.1|
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.6e-19
Family Phage repressors 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296503519|ref|YP_003665219.1|
Sequence length 71
Comment Cro/CI family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MAIIINIDVMLAKRKMSVTELSEKVGITMANLSILKNGKAKAVRFSTLEAICKALECQPG
DILEYQPEDTE
Download sequence
Identical sequences A0A023P774 A0A0D0R8T8 A0A0D0RII7 A0A0D1NMH3 A0A0E8TLY3 A0A0F6FKC6 A0A0G3E6P3 A0A0G4CZD6 A0A0G8ETV8 A0A0K0S9M5 A0A0W7Y380 A0A135WXP3 A0A193CUA3 A0A1C9BV20 A0A1G1UHJ0 A0A1H5Y6F2 A0A1J9TLB9 A0A1M6F0G9 A0A1Q9KQS4 A0A1W2GM60 A0A226QW58 A0A229MMK0 A0A242YPQ5 A0A243AEV9 A0A243DGF4 A0A243DVG7 A0A243E6M2 A0A243F9G9 A0A243GKE6 A0A243IKC5 A0A243JP42 A0A243KE70 A0A243L2Y3 A0A243P276 A0A2B0X8P5 A0A2B4FHV2 A0A2B4LEC2 A0A2C9YPH8 B7H896 C2N246 C2P054 C2R9Q3 C2T2L4 C2UFF8 C2WP15 C2XD48 C3E4X7 C3H2G8 F0PX16 G9Q8V4 J7ZID0 J8H4G9 J8HU67 J8I617 J8JB32 J8LLD0 J8MBF1 J8NCI0 N1LR79 Q81BZ8 R8EDX0 R8H525 R8LJK8 R8PPJ7 R8TWP5 W8YCW8
226900.BC2988 405532.BCB4264_A3005 gi|449089639|ref|YP_007422080.1| gi|30021103|ref|NP_832734.1| gi|218234491|ref|YP_002367713.1| NP_832734.1.86172 WP_000974619.1.100082 WP_000974619.1.100241 WP_000974619.1.10055 WP_000974619.1.100912 WP_000974619.1.101720 WP_000974619.1.10584 WP_000974619.1.10688 WP_000974619.1.10745 WP_000974619.1.10845 WP_000974619.1.1112 WP_000974619.1.11442 WP_000974619.1.11584 WP_000974619.1.12553 WP_000974619.1.13498 WP_000974619.1.1354 WP_000974619.1.13975 WP_000974619.1.14006 WP_000974619.1.14039 WP_000974619.1.14174 WP_000974619.1.14176 WP_000974619.1.15502 WP_000974619.1.17797 WP_000974619.1.1850 WP_000974619.1.18749 WP_000974619.1.18914 WP_000974619.1.19438 WP_000974619.1.19516 WP_000974619.1.20208 WP_000974619.1.20651 WP_000974619.1.21055 WP_000974619.1.21172 WP_000974619.1.2206 WP_000974619.1.2251 WP_000974619.1.22699 WP_000974619.1.22991 WP_000974619.1.23110 WP_000974619.1.23181 WP_000974619.1.23297 WP_000974619.1.23307 WP_000974619.1.23540 WP_000974619.1.23652 WP_000974619.1.24680 WP_000974619.1.24795 WP_000974619.1.25290 WP_000974619.1.25505 WP_000974619.1.25599 WP_000974619.1.25757 WP_000974619.1.26483 WP_000974619.1.26513 WP_000974619.1.26637 WP_000974619.1.26826 WP_000974619.1.26872 WP_000974619.1.26965 WP_000974619.1.27106 WP_000974619.1.27931 WP_000974619.1.28237 WP_000974619.1.29836 WP_000974619.1.29993 WP_000974619.1.30091 WP_000974619.1.32784 WP_000974619.1.32927 WP_000974619.1.33201 WP_000974619.1.33717 WP_000974619.1.34125 WP_000974619.1.34175 WP_000974619.1.34587 WP_000974619.1.35153 WP_000974619.1.35694 WP_000974619.1.36221 WP_000974619.1.37239 WP_000974619.1.37384 WP_000974619.1.3798 WP_000974619.1.38345 WP_000974619.1.38427 WP_000974619.1.38591 WP_000974619.1.39411 WP_000974619.1.39957 WP_000974619.1.40034 WP_000974619.1.40430 WP_000974619.1.41083 WP_000974619.1.41464 WP_000974619.1.41518 WP_000974619.1.4185 WP_000974619.1.41879 WP_000974619.1.42165 WP_000974619.1.42167 WP_000974619.1.42218 WP_000974619.1.43434 WP_000974619.1.43442 WP_000974619.1.43767 WP_000974619.1.43914 WP_000974619.1.44348 WP_000974619.1.44428 WP_000974619.1.44449 WP_000974619.1.4447 WP_000974619.1.44497 WP_000974619.1.44956 WP_000974619.1.45720 WP_000974619.1.46326 WP_000974619.1.47975 WP_000974619.1.49455 WP_000974619.1.4964 WP_000974619.1.49702 WP_000974619.1.5025 WP_000974619.1.50694 WP_000974619.1.50770 WP_000974619.1.51047 WP_000974619.1.51072 WP_000974619.1.51656 WP_000974619.1.51681 WP_000974619.1.54116 WP_000974619.1.54142 WP_000974619.1.54240 WP_000974619.1.54547 WP_000974619.1.54736 WP_000974619.1.54777 WP_000974619.1.55077 WP_000974619.1.5543 WP_000974619.1.55788 WP_000974619.1.56320 WP_000974619.1.57732 WP_000974619.1.58586 WP_000974619.1.58632 WP_000974619.1.58822 WP_000974619.1.59058 WP_000974619.1.59997 WP_000974619.1.60153 WP_000974619.1.60334 WP_000974619.1.61243 WP_000974619.1.61820 WP_000974619.1.61919 WP_000974619.1.62770 WP_000974619.1.62978 WP_000974619.1.6304 WP_000974619.1.63743 WP_000974619.1.63789 WP_000974619.1.63902 WP_000974619.1.64282 WP_000974619.1.64568 WP_000974619.1.64615 WP_000974619.1.6475 WP_000974619.1.64764 WP_000974619.1.65803 WP_000974619.1.66999 WP_000974619.1.67001 WP_000974619.1.674 WP_000974619.1.6743 WP_000974619.1.67873 WP_000974619.1.67912 WP_000974619.1.68007 WP_000974619.1.6816 WP_000974619.1.68346 WP_000974619.1.6846 WP_000974619.1.68562 WP_000974619.1.69501 WP_000974619.1.70108 WP_000974619.1.70181 WP_000974619.1.71114 WP_000974619.1.71242 WP_000974619.1.71648 WP_000974619.1.72484 WP_000974619.1.72912 WP_000974619.1.73396 WP_000974619.1.73457 WP_000974619.1.73594 WP_000974619.1.73790 WP_000974619.1.74302 WP_000974619.1.74372 WP_000974619.1.74651 WP_000974619.1.74832 WP_000974619.1.74857 WP_000974619.1.74976 WP_000974619.1.7534 WP_000974619.1.7544 WP_000974619.1.75866 WP_000974619.1.76086 WP_000974619.1.76155 WP_000974619.1.76804 WP_000974619.1.76883 WP_000974619.1.76902 WP_000974619.1.77370 WP_000974619.1.77386 WP_000974619.1.77567 WP_000974619.1.80126 WP_000974619.1.80239 WP_000974619.1.80571 WP_000974619.1.80649 WP_000974619.1.80964 WP_000974619.1.81000 WP_000974619.1.81570 WP_000974619.1.81773 WP_000974619.1.83228 WP_000974619.1.83694 WP_000974619.1.83977 WP_000974619.1.84614 WP_000974619.1.85592 WP_000974619.1.85928 WP_000974619.1.86374 WP_000974619.1.86619 WP_000974619.1.86637 WP_000974619.1.869 WP_000974619.1.87013 WP_000974619.1.87725 WP_000974619.1.87768 WP_000974619.1.87777 WP_000974619.1.87873 WP_000974619.1.87947 WP_000974619.1.88154 WP_000974619.1.88200 WP_000974619.1.88269 WP_000974619.1.89009 WP_000974619.1.89325 WP_000974619.1.89718 WP_000974619.1.90254 WP_000974619.1.90352 WP_000974619.1.90466 WP_000974619.1.90665 WP_000974619.1.91569 WP_000974619.1.93683 WP_000974619.1.93838 WP_000974619.1.94308 WP_000974619.1.9533 WP_000974619.1.95576 WP_000974619.1.9623 WP_000974619.1.96356 WP_000974619.1.96437 WP_000974619.1.9700 WP_000974619.1.97082 WP_000974619.1.97262 WP_000974619.1.97327 WP_000974619.1.97670 WP_000974619.1.97816 WP_000974619.1.97842 WP_000974619.1.97993 WP_000974619.1.98053 WP_000974619.1.9860 WP_000974619.1.98604 WP_000974619.1.99212 WP_000974619.1.99636 gi|402556796|ref|YP_006598067.1| gi|296503519|ref|YP_003665219.1| gi|384180873|ref|YP_005566635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]