SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296503582|ref|YP_003665282.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296503582|ref|YP_003665282.1|
Domain Number 1 Region: 25-184
Classification Level Classification E-value
Superfamily RmlC-like cupins 4.69e-16
Family TM1459-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296503582|ref|YP_003665282.1|
Sequence length 197
Comment hypothetical protein BMB171_C2751 [Bacillus thuringiensis BMB171]
Sequence
MRSFDLSQTTINISKNDLIYKTNDNKYWVYEVIFQSHEGIPPHSHPFGEDCAVVLSGHLD
YYISNKIMIRASKGEIVFGWKNHIHGYKNNETEPLHLLIFVAPNKIGLEYLPDDDPKIMH
VPEEKRIMKLSEYQVVHSPFSSFERIKIDGEYSEAYNENGLMVFIDIENKQMYIFEGENV
EIKTSNPIVFIKYTARL
Download sequence
Identical sequences A0A1Y6ASG9 A0A243DV02
gi|296503582|ref|YP_003665282.1| WP_001255982.1.33717 WP_001255982.1.38345 WP_001255982.1.41518 WP_001255982.1.68562 WP_001255982.1.71114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]