SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296503830|ref|YP_003665530.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296503830|ref|YP_003665530.1|
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.43e-17
Family Phage repressors 0.036
Further Details:      
 
Domain Number 2 Region: 137-213,256-296
Classification Level Classification E-value
Superfamily TPR-like 0.0000147
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296503830|ref|YP_003665530.1|
Sequence length 374
Comment transcriptional repressor [Bacillus thuringiensis BMB171]
Sequence
MKEINIHKIIADKRKEKGITQEELAAYIGITKASVSKWETGQSYPDITFLPLLASYFNIS
IDELISYTPQMEQEDIKNLYHRLAEAFSEEPFDEVMMECRGIIKKYYSCFPLLIQIGILF
INHHMLTEDTDRGIEILEEAMNLFSRVQEESDDVSLVKEAASFQATCYLILNRPNEVLQL
LGETIRPNFPEEDLIAQAYQMLGNTEKANEVMQISMYQHLIQLVGTIPNYVVVNASSAEK
VEVILNRAFMLIDIYELETLHPNMTLKVYYAAAQVYCMQGNFEGSLEMLRKYAAVCTNSF
TVNSLHLHGDSYFDAIDGWFAEFPLGAKTVRNEEIIKRSMLQTIAENPVFSPMKDVREYK
NIITSLKFKLDIKE
Download sequence
Identical sequences A0A1M6MH11 A0A243DTM7
gi|296503830|ref|YP_003665530.1| WP_000659025.1.14176 WP_000659025.1.19438 WP_000659025.1.25599 WP_000659025.1.32927 WP_000659025.1.41464 WP_000659025.1.41518 WP_000659025.1.6304 WP_000659025.1.6846 WP_000659025.1.71114 WP_000659025.1.85592 WP_000659025.1.86637 WP_000659025.1.96437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]