SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504134|ref|YP_003665834.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504134|ref|YP_003665834.1|
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.84e-18
Family Phage repressors 0.032
Further Details:      
 
Weak hits

Sequence:  gi|296504134|ref|YP_003665834.1|
Domain Number - Region: 98-231
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0915
Family Glycerol-3-phosphate transporter 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296504134|ref|YP_003665834.1|
Sequence length 262
Comment transcriptional repressor [Bacillus thuringiensis BMB171]
Sequence
MGFGEKLFKLRKEKGLSQEALAEKLNTTRQAVSKWENGQGFPETEKLIMIGNVFEVSLDY
LLKETAEQSNEKENGYYVSKEMAEGYIVYGQKISKYIALGFSLLILSTIPYLLFKENATM
STFLVIIIAVLGIGAMMAPVTIEESRYNVLKKEELLFDQNFLKELTNRYAIIKKKYAAVV
IVGFCFIAAGAIPFLFEEKHITSGELVQYYPYCVVLIAIGVYLFVRVLGVLETYRILVEN
KEYSNRFIFKLKKKVRKKVDSL
Download sequence
Identical sequences A0A1J9XII8
WP_000505606.1.13975 gi|296504134|ref|YP_003665834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]