SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504207|ref|YP_003665907.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504207|ref|YP_003665907.1|
Domain Number 1 Region: 91-216
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 2.09e-26
Family LexA-related 0.00053
Further Details:      
 
Domain Number 2 Region: 4-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000239
Family SinR domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296504207|ref|YP_003665907.1|
Sequence length 219
Comment LexA repressor [Bacillus thuringiensis BMB171]
Sequence
MKKAEVVTRLIKEAGYSKRAFAEKIGLPPTTLQSMLSRGIGKASVDNVIKVCKGLGITTD
DLERLTTQEDNTVKEEVSIYETIQNDQSNIIYIPIIGSVAAGTPILAEENIEGYLPMLST
FLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISKSG
SIITLIPLSNDPIHEPKTYDLSAEDVKIIGRVVQAVKNY
Download sequence
Identical sequences A0A243DPB6
gi|296504207|ref|YP_003665907.1| WP_013142108.1.41518 WP_013142108.1.71114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]