SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504281|ref|YP_003665981.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504281|ref|YP_003665981.1|
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000474
Family SinR domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296504281|ref|YP_003665981.1|
Sequence length 303
Comment hypothetical protein BMB171_C3451 [Bacillus thuringiensis BMB171]
Sequence
MTELGQKLKEAREAKGLSIDQLHEITKIQKRHLVAIEEGNYDVLPGAFYARAFIKQYADA
VGLNGEELLVEHQSTIPQSEKREVPQVSTGQKTQETMQKSSSWPIADHMPKILVALLVIA
VGVVIWFVFQALTGKDDEKVPSAQSEKIEVQKAKDSPLDTKKDEVKAEEPKKEEPKKEEP
KKEEQPAQPTGQQEVKVVGTTGKVSTLEIHNNKTLELELSGKGASYVDVKDDAGNVILNA
TVQEGQIEKRDVSTLKEVRLNIGNATNVEVKLNGQVVAYPLDPEKELHQRLVIKNQGIEQ
PAQ
Download sequence
Identical sequences A0A0J7GUQ2 A0A0T8HS83 A0A1M6LXY5 A0A1Q9KHK1 A0A1Y0TR94 A0A229MEU6 A0A243DS14 A0A243KYL6 A0A243MBF3 B7HDQ7 J8F8A4 J8J7C7 J8ME30 Q81A13 R8H1V9
APC25009 gi|218233047|ref|YP_002368585.1| 226900.BC3782 405532.BCB4264_A3881 gi|30021874|ref|NP_833505.1| gi|296504281|ref|YP_003665981.1| NP_833505.1.86172 WP_000137461.1.100082 WP_000137461.1.100912 WP_000137461.1.12553 WP_000137461.1.1354 WP_000137461.1.14006 WP_000137461.1.14174 WP_000137461.1.14176 WP_000137461.1.19438 WP_000137461.1.20208 WP_000137461.1.20651 WP_000137461.1.21055 WP_000137461.1.22699 WP_000137461.1.23652 WP_000137461.1.24680 WP_000137461.1.25290 WP_000137461.1.25599 WP_000137461.1.26637 WP_000137461.1.28237 WP_000137461.1.32784 WP_000137461.1.32927 WP_000137461.1.33717 WP_000137461.1.38345 WP_000137461.1.41464 WP_000137461.1.41518 WP_000137461.1.44956 WP_000137461.1.47975 WP_000137461.1.5025 WP_000137461.1.51072 WP_000137461.1.54240 WP_000137461.1.55116 WP_000137461.1.56320 WP_000137461.1.57732 WP_000137461.1.58822 WP_000137461.1.60153 WP_000137461.1.60334 WP_000137461.1.6304 WP_000137461.1.64282 WP_000137461.1.64568 WP_000137461.1.65803 WP_000137461.1.67001 WP_000137461.1.67873 WP_000137461.1.67912 WP_000137461.1.6846 WP_000137461.1.68562 WP_000137461.1.71114 WP_000137461.1.73396 WP_000137461.1.73790 WP_000137461.1.7593 WP_000137461.1.76086 WP_000137461.1.76155 WP_000137461.1.76804 WP_000137461.1.76902 WP_000137461.1.80126 WP_000137461.1.80649 WP_000137461.1.85348 WP_000137461.1.85592 WP_000137461.1.86619 WP_000137461.1.86637 WP_000137461.1.87768 WP_000137461.1.88154 WP_000137461.1.88200 WP_000137461.1.88269 WP_000137461.1.90352 WP_000137461.1.95576 WP_000137461.1.96437 WP_000137461.1.97262 WP_000137461.1.97842 WP_000137461.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]