SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296504505|ref|YP_003666205.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504505|ref|YP_003666205.1|
Domain Number 1 Region: 61-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.55e-55
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.85e-18
Family GalR/LacI-like bacterial regulator 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296504505|ref|YP_003666205.1|
Sequence length 279
Comment LacI family transcription regulator [Bacillus thuringiensis BMB171]
Sequence
MTVTIKDVAKQANVAPSTVSRVIADNPSISEKTKRRVRKVMSELGYHPNLNARNLANQTT
KTLGLVMPSSASKAFQNPFFPEVIRGISSFAHVEGYALYMSTGETEEEIFNGVVKMVQGR
QIGGIILLYSRENDRIIQYLHEQNFPFVLIGKPYDRKDEITYVDNDNYTAAREVAEYLIS
LGHKQIAFIGGGSDLLVTRDRLAGMSDALKLADIVLPKEYILHFDFSRESGQQAVEELMG
LQQPPTAIMATDDLIGLGVLSALSKKGFVVPKDVSIVSI
Download sequence
Identical sequences gi|296504505|ref|YP_003666205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]