SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504601|ref|YP_003666301.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504601|ref|YP_003666301.1|
Domain Number 1 Region: 58-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.43e-35
Family L-arabinose binding protein-like 0.0012
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.13e-17
Family GalR/LacI-like bacterial regulator 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296504601|ref|YP_003666301.1|
Sequence length 287
Comment ribose operon repressor [Bacillus thuringiensis BMB171]
Sequence
MATIRDVAKLAGVSVATVSRVINEKGYVHEDTVKQVKEAIEELRYRPNSAAKPLFKERST
IIALLVDNLCNQSNITLLHCIEEIAYKEGYQIIICNIENKDRYIHMLKQNNIAGVILTRA
VFKSVGEIPFPFVVIDEQQSHGNYYESGQRAVSLLKEKGCHFLAYFGEGEESEEMEDHIA
GFLDAVWDEGISYREECVQGYTNKQFITLLQNNPYIDGIVASSDQIAIELIRSARFLNIH
IPDKLKIVGPNGSIECEWIGSSLPTIESYVKDNGKVAFQQLKGKIKK
Download sequence
Identical sequences A0A243DR51
gi|296504601|ref|YP_003666301.1| WP_000201362.1.41518 WP_000201362.1.71114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]