SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504729|ref|YP_003666429.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504729|ref|YP_003666429.1|
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000276
Family SinR domain-like 0.03
Further Details:      
 
Domain Number 2 Region: 131-271
Classification Level Classification E-value
Superfamily TPR-like 0.00000000204
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296504729|ref|YP_003666429.1|
Sequence length 289
Comment transcriptional activator PlcR [Bacillus thuringiensis BMB171]
Sequence
MNIASHGKAIRRIRKIRGLSQSELGDGIGGQSFISRIEHGLVLPSIDTLLIIANRLEVPL
EYLLESFRTENFQHITNKKKELRYLVGQGLYPEALQISKNELKAYNSDVDYVCFLKWVEA
ISEYKLGKIRYQQCIAKLQEILESKDTYFSDRNLFLDVQSSIATVYLSAGMLQQAIKNYE
KIIEDNFIYTDENFKVIVLYNYANALKRNGLFKKGIEISEKAISMAKISGKSVVIGPLYY
ILGECKEGLHFHFDEIKACFDKAIYFFKAYDRLDLIEIMKKEHKKYYDE
Download sequence
Identical sequences A0A0T8D3Y0 A0A1M6IKS5 A0A1Y0TRA1 A0A1Y5ZNW4 A0A243DQR8 J8N6N5 R8GTK3
gi|296504729|ref|YP_003666429.1| WP_001017515.1.100912 WP_001017515.1.14176 WP_001017515.1.19438 WP_001017515.1.20651 WP_001017515.1.25599 WP_001017515.1.32927 WP_001017515.1.41464 WP_001017515.1.41518 WP_001017515.1.51072 WP_001017515.1.59997 WP_001017515.1.60153 WP_001017515.1.6304 WP_001017515.1.6846 WP_001017515.1.68562 WP_001017515.1.71114 WP_001017515.1.73396 WP_001017515.1.80126 WP_001017515.1.85592 WP_001017515.1.86637 WP_001017515.1.96437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]