SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504853|ref|YP_003666553.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504853|ref|YP_003666553.1|
Domain Number 1 Region: 54-171
Classification Level Classification E-value
Superfamily RmlC-like cupins 7.36e-22
Family TM1287-like 0.044
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.76e-16
Family SinR domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296504853|ref|YP_003666553.1|
Sequence length 181
Comment MerR family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MNIGSAIREIRQRRGITIAQICEGTGLSKGFMSQVENNKTSPSISTLETISNFLNVPLPY
LLLEQKDRLKIVKKEERKYSVYGKDEQRIEHVAEQGGLRLSLVEIPTGFPKENSPNAHEG
EECHLVLRGKLEVQHGEDIAIVEEGDSFSWNACVPHIVRNIGEETALLLISSYAENRKRV
Y
Download sequence
Identical sequences A0A023PCC9 A0A0A3VQ55 A0A0D0PQF6 A0A0D0PUA7 A0A0D1QV79 A0A0E8TGS8 A0A0F6FND2 A0A0F6JFA8 A0A0G3E2A9 A0A0G4CWT2 A0A0K0SDP7 A0A0Q9FA02 A0A0Q9FQD3 A0A0W7XWS1 A0A135WU47 A0A160LER4 A0A193CY21 A0A1C9BZ14 A0A1G1USW3 A0A1H5WLY8 A0A1I4F973 A0A1M6IEP3 A0A1M7E1U7 A0A1Q9KG14 A0A1W2GFR9 A0A226R908 A0A229MNJ5 A0A242Y736 A0A242ZIV2 A0A242ZR01 A0A243AQF0 A0A243C0K1 A0A243DIF0 A0A243DQD8 A0A243F5G8 A0A243F6D9 A0A243FKL0 A0A243GE06 A0A243HFZ5 A0A243ITU8 A0A243J8Q4 A0A243KIY2 A0A243M044 A0A243M7U9 A0A243N321 A0A2A2P301 A0A2A9HQI4 A0A2C9ZAS3 A0A2H3Q1M9 B5UMT0 B7HDZ6 B7IYL5 C2P400 C2RDK3 C2UJH2 C2WT34 C2XH18 C3E8V0 C3H6J9 G9Q1F9 J3ZWT5 J7WC54 J7ZCH6 J8DNE0 J8FA48 J8FY92 J8HQB1 J8LTH9 J8LVQ6 J8M432 J8N714 J8QUR2 J8YKS7 M1QSB1 N1LZ63 R8CDR0 R8DYT6 R8E173 R8FF36 R8G1M2 R8GCP2 R8GT75 R8IW49 R8K2I0 R8LBA2 R8PKF3 R8RMU5 R8TGI4 R8YMR9 S3JLG3 V5MIG5
gi|218233772|ref|YP_002369171.1| WP_001020693.1.100082 WP_001020693.1.100497 WP_001020693.1.10055 WP_001020693.1.100912 WP_001020693.1.101224 WP_001020693.1.101720 WP_001020693.1.101838 WP_001020693.1.10584 WP_001020693.1.10688 WP_001020693.1.10745 WP_001020693.1.10845 WP_001020693.1.1112 WP_001020693.1.11442 WP_001020693.1.11521 WP_001020693.1.11584 WP_001020693.1.12553 WP_001020693.1.12935 WP_001020693.1.13269 WP_001020693.1.13279 WP_001020693.1.13498 WP_001020693.1.1354 WP_001020693.1.13975 WP_001020693.1.14006 WP_001020693.1.14039 WP_001020693.1.14174 WP_001020693.1.14176 WP_001020693.1.17374 WP_001020693.1.17797 WP_001020693.1.18749 WP_001020693.1.18914 WP_001020693.1.19438 WP_001020693.1.19516 WP_001020693.1.20208 WP_001020693.1.20651 WP_001020693.1.2206 WP_001020693.1.22084 WP_001020693.1.22152 WP_001020693.1.2251 WP_001020693.1.22699 WP_001020693.1.23181 WP_001020693.1.23245 WP_001020693.1.23297 WP_001020693.1.23307 WP_001020693.1.23360 WP_001020693.1.23540 WP_001020693.1.23652 WP_001020693.1.24680 WP_001020693.1.24795 WP_001020693.1.25290 WP_001020693.1.25505 WP_001020693.1.25599 WP_001020693.1.26459 WP_001020693.1.26483 WP_001020693.1.26513 WP_001020693.1.26637 WP_001020693.1.26826 WP_001020693.1.26872 WP_001020693.1.26965 WP_001020693.1.27106 WP_001020693.1.27446 WP_001020693.1.27931 WP_001020693.1.28237 WP_001020693.1.28599 WP_001020693.1.29836 WP_001020693.1.29993 WP_001020693.1.30091 WP_001020693.1.31221 WP_001020693.1.3180 WP_001020693.1.3249 WP_001020693.1.32784 WP_001020693.1.32927 WP_001020693.1.33201 WP_001020693.1.33717 WP_001020693.1.33790 WP_001020693.1.34061 WP_001020693.1.34125 WP_001020693.1.34175 WP_001020693.1.34537 WP_001020693.1.34587 WP_001020693.1.3546 WP_001020693.1.35694 WP_001020693.1.35769 WP_001020693.1.36221 WP_001020693.1.36279 WP_001020693.1.37239 WP_001020693.1.3798 WP_001020693.1.38325 WP_001020693.1.38345 WP_001020693.1.38427 WP_001020693.1.38591 WP_001020693.1.3925 WP_001020693.1.39411 WP_001020693.1.39957 WP_001020693.1.40034 WP_001020693.1.40430 WP_001020693.1.40818 WP_001020693.1.41090 WP_001020693.1.41464 WP_001020693.1.41518 WP_001020693.1.41729 WP_001020693.1.4185 WP_001020693.1.41879 WP_001020693.1.42167 WP_001020693.1.42218 WP_001020693.1.42485 WP_001020693.1.43434 WP_001020693.1.43442 WP_001020693.1.4355 WP_001020693.1.43767 WP_001020693.1.43914 WP_001020693.1.44348 WP_001020693.1.44428 WP_001020693.1.44497 WP_001020693.1.44956 WP_001020693.1.45317 WP_001020693.1.45720 WP_001020693.1.46326 WP_001020693.1.47437 WP_001020693.1.47975 WP_001020693.1.48759 WP_001020693.1.49455 WP_001020693.1.4964 WP_001020693.1.49702 WP_001020693.1.50042 WP_001020693.1.5025 WP_001020693.1.50694 WP_001020693.1.51047 WP_001020693.1.51072 WP_001020693.1.51681 WP_001020693.1.52284 WP_001020693.1.54116 WP_001020693.1.54240 WP_001020693.1.54547 WP_001020693.1.54736 WP_001020693.1.54777 WP_001020693.1.55077 WP_001020693.1.55116 WP_001020693.1.5543 WP_001020693.1.56320 WP_001020693.1.57561 WP_001020693.1.57732 WP_001020693.1.58586 WP_001020693.1.58632 WP_001020693.1.58712 WP_001020693.1.58822 WP_001020693.1.5895 WP_001020693.1.59058 WP_001020693.1.59384 WP_001020693.1.59997 WP_001020693.1.60153 WP_001020693.1.60255 WP_001020693.1.60334 WP_001020693.1.60526 WP_001020693.1.61243 WP_001020693.1.61799 WP_001020693.1.61820 WP_001020693.1.62277 WP_001020693.1.6241 WP_001020693.1.6304 WP_001020693.1.63743 WP_001020693.1.63789 WP_001020693.1.63902 WP_001020693.1.64282 WP_001020693.1.64421 WP_001020693.1.64568 WP_001020693.1.6475 WP_001020693.1.64764 WP_001020693.1.65803 WP_001020693.1.66999 WP_001020693.1.67001 WP_001020693.1.674 WP_001020693.1.6743 WP_001020693.1.67873 WP_001020693.1.67912 WP_001020693.1.68007 WP_001020693.1.6816 WP_001020693.1.68346 WP_001020693.1.6846 WP_001020693.1.68562 WP_001020693.1.69347 WP_001020693.1.69501 WP_001020693.1.70108 WP_001020693.1.70181 WP_001020693.1.70667 WP_001020693.1.71114 WP_001020693.1.71242 WP_001020693.1.71652 WP_001020693.1.72484 WP_001020693.1.72752 WP_001020693.1.73396 WP_001020693.1.73457 WP_001020693.1.73594 WP_001020693.1.73638 WP_001020693.1.73790 WP_001020693.1.74302 WP_001020693.1.74372 WP_001020693.1.74651 WP_001020693.1.74832 WP_001020693.1.74857 WP_001020693.1.74863 WP_001020693.1.74976 WP_001020693.1.7534 WP_001020693.1.7544 WP_001020693.1.75866 WP_001020693.1.75891 WP_001020693.1.7593 WP_001020693.1.75942 WP_001020693.1.76086 WP_001020693.1.76155 WP_001020693.1.76804 WP_001020693.1.76883 WP_001020693.1.76902 WP_001020693.1.77386 WP_001020693.1.77402 WP_001020693.1.77567 WP_001020693.1.79549 WP_001020693.1.80126 WP_001020693.1.80622 WP_001020693.1.80649 WP_001020693.1.81000 WP_001020693.1.81570 WP_001020693.1.81773 WP_001020693.1.83666 WP_001020693.1.83694 WP_001020693.1.83977 WP_001020693.1.84541 WP_001020693.1.84614 WP_001020693.1.84775 WP_001020693.1.85348 WP_001020693.1.85592 WP_001020693.1.85667 WP_001020693.1.8577 WP_001020693.1.85928 WP_001020693.1.86374 WP_001020693.1.86619 WP_001020693.1.86637 WP_001020693.1.86763 WP_001020693.1.869 WP_001020693.1.87013 WP_001020693.1.87649 WP_001020693.1.87705 WP_001020693.1.87725 WP_001020693.1.87768 WP_001020693.1.87777 WP_001020693.1.87873 WP_001020693.1.87947 WP_001020693.1.88154 WP_001020693.1.88200 WP_001020693.1.88269 WP_001020693.1.89009 WP_001020693.1.89145 WP_001020693.1.89718 WP_001020693.1.90254 WP_001020693.1.90352 WP_001020693.1.90452 WP_001020693.1.90466 WP_001020693.1.90665 WP_001020693.1.91020 WP_001020693.1.91367 WP_001020693.1.92555 WP_001020693.1.93683 WP_001020693.1.93838 WP_001020693.1.94308 WP_001020693.1.94914 WP_001020693.1.9533 WP_001020693.1.95576 WP_001020693.1.9623 WP_001020693.1.96272 WP_001020693.1.96287 WP_001020693.1.96437 WP_001020693.1.9700 WP_001020693.1.9703 WP_001020693.1.97082 WP_001020693.1.97262 WP_001020693.1.97561 WP_001020693.1.97670 WP_001020693.1.97816 WP_001020693.1.97821 WP_001020693.1.97830 WP_001020693.1.97842 WP_001020693.1.97993 WP_001020693.1.98053 WP_001020693.1.98315 WP_001020693.1.9860 WP_001020693.1.98604 WP_001020693.1.99212 WP_001020693.1.99636 gi|218899530|ref|YP_002447941.1| gi|449091327|ref|YP_007423768.1| gi|384188434|ref|YP_005574330.1| gi|296504853|ref|YP_003666553.1| gi|434377528|ref|YP_006612172.1| gi|558683031|ref|YP_008821160.1| gi|402564163|ref|YP_006606887.1| gi|410676749|ref|YP_006929120.1| gi|452200826|ref|YP_007480907.1| 405531.BCG9842_B0755 405532.BCB4264_A4481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]