SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296505028|ref|YP_003666728.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296505028|ref|YP_003666728.1|
Domain Number 1 Region: 338-567
Classification Level Classification E-value
Superfamily PHP domain-like 1.57e-56
Family PHP domain 0.0011
Further Details:      
 
Domain Number 2 Region: 154-316
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 9.81e-46
Family DNA polymerase beta-like 0.0035
Further Details:      
 
Domain Number 3 Region: 2-79
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.19e-20
Family DNA polymerase beta, N-terminal domain-like 0.003
Further Details:      
 
Domain Number 4 Region: 48-145
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0000000178
Family Achaeal helicase C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296505028|ref|YP_003666728.1|
Sequence length 572
Comment hypothetical protein BMB171_C4199 [Bacillus thuringiensis BMB171]
Sequence
MKVNKKQVIKLLETIGLFMELKGANPFKISAFRKAAAALESDDRSLSEIEDFTKIPGIGK
GTAAVIQEYIESGTSEVLQELEKEVPSSLLPLLKLPGLGGKKVAKLYKELGVVDMESLKA
VCEENKVQALAGFGKKTEEKILEAIDQVGSRPERLPIAMVLPIAGEIEEKLSNIAEVIRF
SRAGSLRRVRETVKDLDFIIATTEPAAVREHLLQFDNMIEVIASGDTKVSVRLQYEYDIS
IDFRLVKPEEFITTLHHFTGSKDHNVKMRQIAKDKGEKISEYGVENLETGEVKTFETEED
FFAHFGLPFIPPEVREDGKEIELIKEYPNLIQFSDIQGDLHMHTTWSDGAFSIEEMVQAC
RARGYKFMAITDHSQYLKVANGLTKERLREQAKEIERMNEKYPDITILRGIEMDILPDAS
LDFDDEVLAELDYVIGAIHSSFSQDRETIMKRLRTALENKHVTMIAHPTGRLLGRREGYD
VDTDLLIELAKETNTVLELNANPNRLDLSAKLLKQAQDAGVKVAINTDAHTLEMLEDMET
GVAAARKGWIQKDNVINTWDIERLLDYIKRNK
Download sequence
Identical sequences A0A0J6Z420 A0A0S3C2Y1 A0A0T8XXL4 A0A229MP43 A0A243DDT9 A0A243DPW6 A0A243GD92 A0A243HHR3 A0A243K1B3 J8M0E2 J8MHM3 R8GQH2 R8TC90
WP_000867532.1.100082 WP_000867532.1.10055 WP_000867532.1.100912 WP_000867532.1.10584 WP_000867532.1.12553 WP_000867532.1.1354 WP_000867532.1.14039 WP_000867532.1.20208 WP_000867532.1.20651 WP_000867532.1.23652 WP_000867532.1.25505 WP_000867532.1.26513 WP_000867532.1.30091 WP_000867532.1.32784 WP_000867532.1.33201 WP_000867532.1.33717 WP_000867532.1.3798 WP_000867532.1.38345 WP_000867532.1.41518 WP_000867532.1.45317 WP_000867532.1.46326 WP_000867532.1.47975 WP_000867532.1.51072 WP_000867532.1.54736 WP_000867532.1.55116 WP_000867532.1.60153 WP_000867532.1.60334 WP_000867532.1.63902 WP_000867532.1.64568 WP_000867532.1.65803 WP_000867532.1.67001 WP_000867532.1.67873 WP_000867532.1.67912 WP_000867532.1.68562 WP_000867532.1.71114 WP_000867532.1.73396 WP_000867532.1.73457 WP_000867532.1.73594 WP_000867532.1.73790 WP_000867532.1.76155 WP_000867532.1.76804 WP_000867532.1.80126 WP_000867532.1.81773 WP_000867532.1.86637 WP_000867532.1.88154 WP_000867532.1.88200 WP_000867532.1.95576 WP_000867532.1.97670 WP_000867532.1.98604 WP_000867532.1.99212 gi|296505028|ref|YP_003666728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]