SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296505143|ref|YP_003666843.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296505143|ref|YP_003666843.1|
Domain Number 1 Region: 62-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.67e-91
Family L-arabinose binding protein-like 0.00000000391
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.44e-20
Family GalR/LacI-like bacterial regulator 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296505143|ref|YP_003666843.1|
Sequence length 332
Comment catabolite control protein A [Bacillus thuringiensis BMB171]
Sequence
MNVTIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIDRLGYRPNAVARGLASKKT
TTVGVIIPDISNTFYAELARGIEDIATMYKYNIILSNSDQNKEKEFHLLNTMLGKQVDGI
VFMGEDITDIHIEEFKKSPVPIVLAASFDEQNETPSVNIDYTQAAYDAMKHFIEQGHKRI
GFVSGPFIDKAGSAKKLQGYKKALEEAGISYDENLVIDGDYTYDSGIEAFEKLWSNDEKP
TAIFVSSDEMALGVIHAAQDAGLNVPTDVEVLGFDNTRLALMVRPQLSTVVQPMYDIGAV
AMRLLTKYMNKEKVEDHTVILPHRIQFRDSTK
Download sequence
Identical sequences A0A023PDJ1 A0A0A3VM40 A0A0E8T5C4 A0A0F6FUX0 A0A0G4CTI7 A0A0K0SEQ6 A0A0W7Y7S8 A0A135WTQ7 A0A193CYK4 A0A1G1UTR8 A0A1M6MT71 A0A1Q9KSD2 A0A1W2GEU4 A0A229MPR9 A0A242ZKL6 A0A243BZF8 A0A243D7J1 A0A243DPI8 A0A243EW35 A0A243HHU3 A0A243IKH1 A0A243J8H2 A0A243M6Q7 A0A243N2B8 B5UNN7 B7H737 C2NAZ5 C2P504 C2REE1 C2T6Z7 C2WTZ0 G9Q0J9 H9NA83 J8IV33 J8JPA3 J8MHX9 J8MKI6 N1LUH4 Q816Y7 R8ECT5 R8GQT1 R8L8A8 R8PJ92 R8TGN5 W8Y9P7
226900.BC4672 405532.BCB4264_A4790 gi|218232748|ref|YP_002369476.1| NP_834378.1.86172 WP_001103297.1.100082 WP_001103297.1.10055 WP_001103297.1.100912 WP_001103297.1.101224 WP_001103297.1.10584 WP_001103297.1.10688 WP_001103297.1.10745 WP_001103297.1.10845 WP_001103297.1.1112 WP_001103297.1.11584 WP_001103297.1.12553 WP_001103297.1.13498 WP_001103297.1.1354 WP_001103297.1.14006 WP_001103297.1.14039 WP_001103297.1.14174 WP_001103297.1.14176 WP_001103297.1.18749 WP_001103297.1.19438 WP_001103297.1.19516 WP_001103297.1.20208 WP_001103297.1.21055 WP_001103297.1.2206 WP_001103297.1.2251 WP_001103297.1.23181 WP_001103297.1.23307 WP_001103297.1.23652 WP_001103297.1.24680 WP_001103297.1.24795 WP_001103297.1.25290 WP_001103297.1.25599 WP_001103297.1.26483 WP_001103297.1.26513 WP_001103297.1.26637 WP_001103297.1.26826 WP_001103297.1.26872 WP_001103297.1.26965 WP_001103297.1.27106 WP_001103297.1.27931 WP_001103297.1.28237 WP_001103297.1.29836 WP_001103297.1.29993 WP_001103297.1.31221 WP_001103297.1.3180 WP_001103297.1.32784 WP_001103297.1.32927 WP_001103297.1.33201 WP_001103297.1.33717 WP_001103297.1.34175 WP_001103297.1.34587 WP_001103297.1.35694 WP_001103297.1.37239 WP_001103297.1.3798 WP_001103297.1.38345 WP_001103297.1.38427 WP_001103297.1.38591 WP_001103297.1.39411 WP_001103297.1.39957 WP_001103297.1.40034 WP_001103297.1.40430 WP_001103297.1.41464 WP_001103297.1.41518 WP_001103297.1.4185 WP_001103297.1.41879 WP_001103297.1.42167 WP_001103297.1.42218 WP_001103297.1.42485 WP_001103297.1.43442 WP_001103297.1.43767 WP_001103297.1.43914 WP_001103297.1.44348 WP_001103297.1.44428 WP_001103297.1.44497 WP_001103297.1.44956 WP_001103297.1.45317 WP_001103297.1.45720 WP_001103297.1.46326 WP_001103297.1.47000 WP_001103297.1.47437 WP_001103297.1.47975 WP_001103297.1.49455 WP_001103297.1.4964 WP_001103297.1.49702 WP_001103297.1.5025 WP_001103297.1.50694 WP_001103297.1.51047 WP_001103297.1.51072 WP_001103297.1.51681 WP_001103297.1.54142 WP_001103297.1.54240 WP_001103297.1.54736 WP_001103297.1.54777 WP_001103297.1.55116 WP_001103297.1.5543 WP_001103297.1.56320 WP_001103297.1.57732 WP_001103297.1.58632 WP_001103297.1.58822 WP_001103297.1.59058 WP_001103297.1.59997 WP_001103297.1.60153 WP_001103297.1.60334 WP_001103297.1.61243 WP_001103297.1.62770 WP_001103297.1.6304 WP_001103297.1.63743 WP_001103297.1.63789 WP_001103297.1.63902 WP_001103297.1.64282 WP_001103297.1.64568 WP_001103297.1.6475 WP_001103297.1.64764 WP_001103297.1.65803 WP_001103297.1.66999 WP_001103297.1.67001 WP_001103297.1.674 WP_001103297.1.6743 WP_001103297.1.67873 WP_001103297.1.67912 WP_001103297.1.68007 WP_001103297.1.68346 WP_001103297.1.6846 WP_001103297.1.68562 WP_001103297.1.69501 WP_001103297.1.70181 WP_001103297.1.71114 WP_001103297.1.72484 WP_001103297.1.73396 WP_001103297.1.73457 WP_001103297.1.73594 WP_001103297.1.73790 WP_001103297.1.74302 WP_001103297.1.74372 WP_001103297.1.74832 WP_001103297.1.74857 WP_001103297.1.74863 WP_001103297.1.74976 WP_001103297.1.75866 WP_001103297.1.7593 WP_001103297.1.76086 WP_001103297.1.76804 WP_001103297.1.76902 WP_001103297.1.77386 WP_001103297.1.77567 WP_001103297.1.80126 WP_001103297.1.80649 WP_001103297.1.81000 WP_001103297.1.81570 WP_001103297.1.81773 WP_001103297.1.83694 WP_001103297.1.83977 WP_001103297.1.85348 WP_001103297.1.85592 WP_001103297.1.85928 WP_001103297.1.86619 WP_001103297.1.86637 WP_001103297.1.869 WP_001103297.1.87013 WP_001103297.1.87725 WP_001103297.1.87768 WP_001103297.1.87777 WP_001103297.1.88200 WP_001103297.1.88269 WP_001103297.1.89009 WP_001103297.1.89718 WP_001103297.1.90254 WP_001103297.1.90352 WP_001103297.1.90466 WP_001103297.1.90665 WP_001103297.1.93683 WP_001103297.1.94308 WP_001103297.1.95576 WP_001103297.1.9623 WP_001103297.1.96287 WP_001103297.1.96437 WP_001103297.1.97082 WP_001103297.1.97262 WP_001103297.1.97561 WP_001103297.1.97670 WP_001103297.1.97842 WP_001103297.1.9860 WP_001103297.1.99212 WP_001103297.1.99636 gi|30022747|ref|NP_834378.1| gi|296505143|ref|YP_003666843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]