SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296505465|ref|YP_003667165.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296505465|ref|YP_003667165.1|
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.02e-18
Family SinR domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296505465|ref|YP_003667165.1|
Sequence length 73
Comment PbsX family transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence
MKLQNRVRELRAKHRLSQGDLGKAIGSSRQTISLIERGDYAPSIVLSLKIAQIFNVPVEE
IFTLVEGEEDDEE
Download sequence
Identical sequences A0A023PDH2 A0A063CK13 A0A0D1PT76 A0A0E8T8X4 A0A0F6FNC9 A0A0G4CT21 A0A0W7YF97 A0A135WNS3 A0A150EG22 A0A193CZP0 A0A1B1SRR3 A0A1C9C102 A0A1G1UIK4 A0A1I4KJ24 A0A1J9TWM2 A0A1K0AEV2 A0A1M6F6X3 A0A1Q9KT70 A0A1W2GD19 A0A229M418 A0A229M4L8 A0A242YSS4 A0A243CD90 A0A243DM97 A0A243DUU4 A0A243EMU4 A0A243F1A9 A0A243HPW1 A0A243IXQ2 A0A243KNL9 A0A243LAZ7 A0A243MUI0 A0A243NG41 A0A2A9AHI7 A0A2G6QGS6 B5UPK8 B7HD54 B7HVV4 B9J4D3 G9QD45 J8I0E0 J8L5N5 J8L741 J8MFI4 J8N1D6 N1LIN6 R8EAV3 R8GVB6 R8L4T2 R8P6D9 R8T7U3 W8YIU3
gi|218234825|ref|YP_002369834.1| gi|449092050|ref|YP_007424491.1| gi|296505465|ref|YP_003667165.1| gi|217962506|ref|YP_002341078.1| 361100.BCQ_4849 405532.BCB4264_A5175 405534.BCAH187_A5184 gi|222098481|ref|YP_002532539.1| WP_000776168.1.100082 WP_000776168.1.10055 WP_000776168.1.100684 WP_000776168.1.10069 WP_000776168.1.100912 WP_000776168.1.101224 WP_000776168.1.101309 WP_000776168.1.10584 WP_000776168.1.10688 WP_000776168.1.10762 WP_000776168.1.10845 WP_000776168.1.1112 WP_000776168.1.11584 WP_000776168.1.1228 WP_000776168.1.12553 WP_000776168.1.12751 WP_000776168.1.13024 WP_000776168.1.13299 WP_000776168.1.1354 WP_000776168.1.14006 WP_000776168.1.14039 WP_000776168.1.14174 WP_000776168.1.14176 WP_000776168.1.17408 WP_000776168.1.18749 WP_000776168.1.18840 WP_000776168.1.18914 WP_000776168.1.19438 WP_000776168.1.19516 WP_000776168.1.20208 WP_000776168.1.20651 WP_000776168.1.20687 WP_000776168.1.21055 WP_000776168.1.21643 WP_000776168.1.2206 WP_000776168.1.2251 WP_000776168.1.226 WP_000776168.1.22699 WP_000776168.1.23100 WP_000776168.1.23181 WP_000776168.1.23307 WP_000776168.1.23540 WP_000776168.1.23652 WP_000776168.1.24184 WP_000776168.1.24377 WP_000776168.1.24795 WP_000776168.1.25290 WP_000776168.1.25599 WP_000776168.1.26450 WP_000776168.1.26483 WP_000776168.1.26499 WP_000776168.1.26513 WP_000776168.1.26637 WP_000776168.1.26965 WP_000776168.1.27106 WP_000776168.1.27334 WP_000776168.1.27931 WP_000776168.1.28237 WP_000776168.1.28913 WP_000776168.1.29209 WP_000776168.1.29836 WP_000776168.1.29993 WP_000776168.1.30317 WP_000776168.1.31221 WP_000776168.1.31503 WP_000776168.1.31685 WP_000776168.1.3180 WP_000776168.1.32522 WP_000776168.1.32784 WP_000776168.1.32927 WP_000776168.1.33045 WP_000776168.1.33061 WP_000776168.1.3318 WP_000776168.1.33201 WP_000776168.1.33717 WP_000776168.1.34175 WP_000776168.1.34587 WP_000776168.1.35518 WP_000776168.1.3561 WP_000776168.1.3615 WP_000776168.1.36221 WP_000776168.1.37093 WP_000776168.1.37239 WP_000776168.1.37384 WP_000776168.1.3798 WP_000776168.1.37990 WP_000776168.1.38345 WP_000776168.1.38427 WP_000776168.1.38591 WP_000776168.1.39411 WP_000776168.1.39538 WP_000776168.1.39957 WP_000776168.1.40034 WP_000776168.1.40430 WP_000776168.1.41464 WP_000776168.1.41518 WP_000776168.1.4185 WP_000776168.1.41879 WP_000776168.1.42167 WP_000776168.1.42218 WP_000776168.1.42485 WP_000776168.1.43442 WP_000776168.1.43762 WP_000776168.1.43767 WP_000776168.1.43914 WP_000776168.1.44348 WP_000776168.1.44428 WP_000776168.1.44463 WP_000776168.1.44497 WP_000776168.1.44956 WP_000776168.1.45317 WP_000776168.1.45720 WP_000776168.1.46326 WP_000776168.1.46746 WP_000776168.1.46864 WP_000776168.1.47000 WP_000776168.1.47097 WP_000776168.1.47437 WP_000776168.1.47975 WP_000776168.1.48164 WP_000776168.1.48311 WP_000776168.1.48599 WP_000776168.1.49428 WP_000776168.1.49455 WP_000776168.1.4964 WP_000776168.1.49702 WP_000776168.1.5025 WP_000776168.1.50316 WP_000776168.1.50514 WP_000776168.1.50694 WP_000776168.1.51047 WP_000776168.1.51072 WP_000776168.1.51087 WP_000776168.1.51335 WP_000776168.1.52756 WP_000776168.1.54142 WP_000776168.1.54240 WP_000776168.1.54547 WP_000776168.1.54736 WP_000776168.1.54775 WP_000776168.1.54777 WP_000776168.1.54782 WP_000776168.1.55057 WP_000776168.1.55077 WP_000776168.1.55116 WP_000776168.1.5543 WP_000776168.1.56055 WP_000776168.1.56320 WP_000776168.1.56549 WP_000776168.1.57203 WP_000776168.1.57732 WP_000776168.1.57815 WP_000776168.1.57859 WP_000776168.1.58586 WP_000776168.1.58632 WP_000776168.1.58814 WP_000776168.1.58822 WP_000776168.1.59058 WP_000776168.1.59773 WP_000776168.1.59997 WP_000776168.1.60153 WP_000776168.1.60274 WP_000776168.1.60334 WP_000776168.1.61231 WP_000776168.1.61243 WP_000776168.1.62770 WP_000776168.1.6304 WP_000776168.1.6340 WP_000776168.1.63743 WP_000776168.1.63789 WP_000776168.1.63902 WP_000776168.1.64282 WP_000776168.1.64377 WP_000776168.1.64568 WP_000776168.1.64666 WP_000776168.1.6475 WP_000776168.1.64764 WP_000776168.1.65803 WP_000776168.1.67001 WP_000776168.1.674 WP_000776168.1.6743 WP_000776168.1.6753 WP_000776168.1.67873 WP_000776168.1.67912 WP_000776168.1.68007 WP_000776168.1.68346 WP_000776168.1.6846 WP_000776168.1.68562 WP_000776168.1.69347 WP_000776168.1.69501 WP_000776168.1.70108 WP_000776168.1.70181 WP_000776168.1.70645 WP_000776168.1.71114 WP_000776168.1.72514 WP_000776168.1.73396 WP_000776168.1.73457 WP_000776168.1.73594 WP_000776168.1.73790 WP_000776168.1.7398 WP_000776168.1.74302 WP_000776168.1.74372 WP_000776168.1.74832 WP_000776168.1.74857 WP_000776168.1.74863 WP_000776168.1.74976 WP_000776168.1.7534 WP_000776168.1.75866 WP_000776168.1.75891 WP_000776168.1.76086 WP_000776168.1.76155 WP_000776168.1.7628 WP_000776168.1.76804 WP_000776168.1.76883 WP_000776168.1.76902 WP_000776168.1.77386 WP_000776168.1.77576 WP_000776168.1.77690 WP_000776168.1.79658 WP_000776168.1.80126 WP_000776168.1.80649 WP_000776168.1.81000 WP_000776168.1.81088 WP_000776168.1.81570 WP_000776168.1.81773 WP_000776168.1.82533 WP_000776168.1.82986 WP_000776168.1.83694 WP_000776168.1.83977 WP_000776168.1.84337 WP_000776168.1.8450 WP_000776168.1.85348 WP_000776168.1.85592 WP_000776168.1.85928 WP_000776168.1.86374 WP_000776168.1.86619 WP_000776168.1.86637 WP_000776168.1.869 WP_000776168.1.87013 WP_000776168.1.87725 WP_000776168.1.87768 WP_000776168.1.87777 WP_000776168.1.87947 WP_000776168.1.88154 WP_000776168.1.88200 WP_000776168.1.88269 WP_000776168.1.88431 WP_000776168.1.89009 WP_000776168.1.8923 WP_000776168.1.89718 WP_000776168.1.90254 WP_000776168.1.90352 WP_000776168.1.90466 WP_000776168.1.90665 WP_000776168.1.91404 WP_000776168.1.91615 WP_000776168.1.93683 WP_000776168.1.93838 WP_000776168.1.93932 WP_000776168.1.94308 WP_000776168.1.9533 WP_000776168.1.95457 WP_000776168.1.95484 WP_000776168.1.95576 WP_000776168.1.9623 WP_000776168.1.96287 WP_000776168.1.96437 WP_000776168.1.97082 WP_000776168.1.97262 WP_000776168.1.97561 WP_000776168.1.97670 WP_000776168.1.97842 WP_000776168.1.97993 WP_000776168.1.9860 WP_000776168.1.98604 WP_000776168.1.99212 WP_000776168.1.99266 WP_000776168.1.99636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]