SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296505774|ref|YP_003667474.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296505774|ref|YP_003667474.1|
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000282
Family SinR domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 155-255
Classification Level Classification E-value
Superfamily TPR-like 0.0000000481
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296505774|ref|YP_003667474.1|
Sequence length 285
Comment transcriptional activator PlcR [Bacillus thuringiensis BMB171]
Sequence
MHAEKLGSEIKKIRVMRGLTQKQLSDNICHQSEVSRIESGAVYPSMDILQGIAAKLQVPI
IHFYEVLIYSDIERKKQFKDQIIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYH
VAAYILKKIDYEYCILELKKLLNQQLAGIDVYQNLYIENAIANIYAENSYFKKSIELFED
ILKQLEVLHDNEEFEVKVRYNHAKALYLDNQYEESLYQVNKAIEISCRINSMALIGQLYY
QRGECLGKLEYDGAEVEDAYKKASFFFDILEMHTYKEALVNKISR
Download sequence
Identical sequences A0A0T8E4Y1 A0A1Y0TP43 A0A229MIC2 A0A243DL33 C2T909 J8N1B6 Q5U8V2 Q814S2 Q9XCQ6 R8GW89
226900.BC5350 gi|30023380|ref|NP_835011.1| gi|296505774|ref|YP_003667474.1| APC26213 NP_835011.1.86172 WP_000542912.1.100912 WP_000542912.1.20208 WP_000542912.1.20651 WP_000542912.1.26637 WP_000542912.1.33201 WP_000542912.1.41518 WP_000542912.1.51072 WP_000542912.1.55116 WP_000542912.1.56320 WP_000542912.1.58822 WP_000542912.1.59997 WP_000542912.1.60153 WP_000542912.1.65803 WP_000542912.1.67001 WP_000542912.1.67912 WP_000542912.1.71114 WP_000542912.1.73396 WP_000542912.1.76902 WP_000542912.1.80126 WP_000542912.1.80649 WP_000542912.1.86637 WP_000542912.1.87768 WP_000542912.1.88200 WP_000542912.1.97842 WP_000542912.1.97993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]