SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296506587|ref|YP_003667821.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296506587|ref|YP_003667821.1|
Domain Number 1 Region: 195-340
Classification Level Classification E-value
Superfamily TPR-like 6.32e-18
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.21e-16
Family SinR domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 120-226
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000145
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 4 Region: 315-420
Classification Level Classification E-value
Superfamily TPR-like 0.00000000436
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296506587|ref|YP_003667821.1|
Sequence length 421
Comment helix-turn-helix/TPR domain-containing protein [Bacillus thuringiensis BMB171]
Sequence
MLGQRIKELRKQKKLTQEKLADGIITRSYLSQIEKGLIQPSYEVLEALSNKLNCSVEDFF
DVVENKELTLSQIKKDIKAAENHTTANLWDKVKNFIEQKNYFNHPDVNKYDEGILNWIHG
KYYEHIHDFNHAIPYFTKSISLLKEGNYVNELVRSLDSLGYLYSRINNHETALSTLNRAY
KIIIHEQISGILRVSLLANLGIVHGRLSEYYSAINFLEEAIEQNEQTRTHYKAGEIYMAL
GICNMELQRFDQAKKANEKALKFFKLNENKLYEAGTYTNLGILSSYKKEFHQAQLSFKTA
LNLYTQNNAKPNEIMNVQVELAKSYFAQKDYESAKSICFDTIETKSKNKHKAQAYELLGD
IYLEESNEELALKYYMEAKEIAEFISPNNKQVCRQICKKIGDCYVVLKDFEKSAYYYQEC
F
Download sequence
Identical sequences A0A0F5RIP6 A0A0U0J3N1 A0A229MBG8 A0A243DU46 A0A2K1RSI4 A1BZS1 B7JU43 C2UNR2 Q74NS7
222523.BCE_A0167 405535.BCAH820_B0295 gi|218848240|ref|YP_002455177.1|NC_011777 gi|296506587|ref|YP_003667821.1|NC_014172 gi|44004506|ref|NP_982174.1|NC_005707 gi|44004506|ref|NP_982174.1| gi|296506587|ref|YP_003667821.1| WP_000901453.1.13299 WP_000901453.1.16013 WP_000901453.1.16199 WP_000901453.1.20208 WP_000901453.1.20651 WP_000901453.1.26847 WP_000901453.1.29804 WP_000901453.1.35255 WP_000901453.1.39001 WP_000901453.1.40430 WP_000901453.1.41518 WP_000901453.1.46244 WP_000901453.1.46746 WP_000901453.1.46864 WP_000901453.1.47975 WP_000901453.1.55116 WP_000901453.1.59058 WP_000901453.1.61231 WP_000901453.1.63137 WP_000901453.1.64666 WP_000901453.1.67001 WP_000901453.1.67873 WP_000901453.1.69970 WP_000901453.1.71114 WP_000901453.1.7545 WP_000901453.1.76902 WP_000901453.1.80649 WP_000901453.1.81773 WP_000901453.1.8907 WP_000901453.1.97842 WP_000901453.1.98604 gi|218848240|ref|YP_002455177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]